Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P25106
Molecular weight:
16.82 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Asp2–Ser41
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO

Product name ARO-P10786-100
Uniprot ID P25106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKS
Molecular weight 16.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Ser41
Aliases /Synonyms CXCR-7, RDC1, C-X-C chemokine receptor type 7, RDC-1, Chemokine orphan receptor 1, G-protein coupled receptor 159, Atypical chemokine receptor 3, CMKOR1, CXCR7, GPR159, G-protein coupled receptor RDC1 homolog, ACKR3, CXC-R7
Reference ARO-P10786
Note For research use only.
Molecular Constructor
Asp2–Ser41
Product name ARO-P10786-1MG
Uniprot ID P25106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKS
Molecular weight 16.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Ser41
Aliases /Synonyms CXCR-7, RDC1, C-X-C chemokine receptor type 7, RDC-1, Chemokine orphan receptor 1, G-protein coupled receptor 159, Atypical chemokine receptor 3, CMKOR1, CXCR7, GPR159, G-protein coupled receptor RDC1 homolog, ACKR3, CXC-R7
Reference ARO-P10786
Note For research use only.
Molecular Constructor
Asp2–Ser41
Product name ARO-P10786-50
Uniprot ID P25106
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKS
Molecular weight 16.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp2-Ser41
Aliases /Synonyms CXCR-7, RDC1, C-X-C chemokine receptor type 7, RDC-1, Chemokine orphan receptor 1, G-protein coupled receptor 159, Atypical chemokine receptor 3, CMKOR1, CXCR7, GPR159, G-protein coupled receptor RDC1 homolog, ACKR3, CXC-R7
Reference ARO-P10786
Note For research use only.
Molecular Constructor
Asp2–Ser41

Introduction to Recombinant Human CXCR7/ACKR3 Protein

Recombinant Human CXCR7/ACKR3 Protein, also known as C-X-C chemokine receptor type 7/Atypical chemokine receptor 3, is a transmembrane protein that belongs to the G-protein coupled receptor (GPCR) family. This protein is encoded by the CXCR7 gene and is expressed on the surface of various cell types, including immune cells, endothelial cells, and cancer cells.

Structure of Recombinant Human CXCR7/ACKR3 Protein

The recombinant form of CXCR7/ACKR3 protein is a 362 amino acid long protein with a molecular weight of approximately 40 kDa. It consists of seven transmembrane domains, an extracellular N-terminus, and an intracellular C-terminus. The extracellular domain contains two highly conserved cysteine residues, which are important for the formation of disulfide bonds and proper protein folding.

The intracellular domain of CXCR7/ACKR3 protein contains several conserved motifs, including the DRY motif, which is involved in G-protein coupling, and the NPXXY motif, which is important for receptor internalization and desensitization. This protein also has a C-terminal tail that is responsible for interacting with various signaling molecules and regulating downstream signaling pathways.

Activity of Recombinant Human CXCR7/ACKR3 Protein

CXCR7/ACKR3 protein acts as a receptor for several chemokines, including CXCL11, CXCL12, and CXCL16. These chemokines bind to the extracellular domain of CXCR7/ACKR3 and activate downstream signaling pathways through G-protein coupled mechanisms.

One of the main functions of CXCR7/ACKR3 protein is to regulate the trafficking of immune cells. It is involved in the recruitment of immune cells to sites of inflammation, as well as in the maintenance of immune cell homeostasis. This protein also plays a role in angiogenesis, the process of forming new blood vessels, by promoting the migration and proliferation of endothelial cells.

In addition, CXCR7/ACKR3 protein has been implicated in various diseases, including cancer. It has been shown to be overexpressed in several types of cancer, and its activation has been linked to tumor growth, invasion, and metastasis. This makes CXCR7/ACKR3 an attractive target for therapeutic interventions in cancer treatment.

Application of Recombinant Human CXCR7/ACKR3 Protein

The recombinant form of CXCR7/ACKR3 protein has been widely used in research and drug development. It is commonly used as an antigen in immunological studies, as well as in the production of specific antibodies against CXCR7/ACKR3. Recombinant CXCR7/ACKR3 protein can also be used in high-throughput screening assays to identify potential drug candidates that target this protein.

Furthermore, the therapeutic potential of CXCR7/ACKR3 protein has been explored in various studies. Recombinant CXCR7/ACKR3 protein has been used as a potential therapeutic agent in cancer treatment, either as a standalone therapy or in combination with other drugs. It has also been investigated as a potential target for anti-inflammatory drugs in diseases such as rheumatoid arthritis and multiple sclerosis.

In conclusion, Recombinant Human CXCR7/ACKR3 Protein is a crucial player in various biological processes, including immune cell trafficking, angiogenesis, and cancer progression. Its unique structure and activity make it an important target for research and drug development. With its potential as a therapeutic agent, CXCR7/ACKR3 protein holds promise for the treatment of various diseases and continues to be a subject of interest in the scientific community.

Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products