Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC25A37 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NYZ2
Molecular weight:
32.93 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Pro65–Arg105
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC25A37 Protein, N-GST & C-His

Product name ARO-P11347-100
Uniprot ID Q9NYZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLR
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro65-Arg105
Aliases /Synonyms SLC25A37, Solute carrier family 25 member 37, Mitochondrial iron transporter 1, MSCP, Mitochondrial solute carrier protein, MFRN, Mitoferrin-1
Reference ARO-P11347
Note For research use only.
Molecular Constructor
Pro65–Arg105
Product name ARO-P11347-1MG
Uniprot ID Q9NYZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLR
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro65-Arg105
Aliases /Synonyms SLC25A37, Solute carrier family 25 member 37, Mitochondrial iron transporter 1, MSCP, Mitochondrial solute carrier protein, MFRN, Mitoferrin-1
Reference ARO-P11347
Note For research use only.
Molecular Constructor
Pro65–Arg105
Product name ARO-P11347-50
Uniprot ID Q9NYZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLR
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro65-Arg105
Aliases /Synonyms SLC25A37, Solute carrier family 25 member 37, Mitochondrial iron transporter 1, MSCP, Mitochondrial solute carrier protein, MFRN, Mitoferrin-1
Reference ARO-P11347
Note For research use only.
Molecular Constructor
Pro65–Arg105

Recombinant Human SLC25A37 Protein: A Versatile Antigen for Biomedical Research

Recombinant proteins have become an essential tool in biomedical research due to their ability to mimic naturally occurring proteins and their potential for therapeutic applications. One such recombinant protein that has gained significant attention in recent years is the Human SLC25A37 protein. This protein, also known as the mitochondrial solute carrier 25A37, has a crucial role in cellular metabolism and has been linked to various diseases. In this article, we will explore the structure, activity, and potential applications of recombinant Human SLC25A37 protein.

Structure of Recombinant Human SLC25A37 Protein

The Human SLC25A37 protein is a member of the mitochondrial carrier family, which is a group of proteins that transport metabolites across the mitochondrial inner membrane. It is a 34-kDa protein with six transmembrane domains and a conserved sequence motif that is characteristic of the mitochondrial carrier family. The recombinant form of this protein is produced by cloning the gene encoding it into a suitable expression vector and expressing it in a host organism, typically Escherichia coli or yeast. Recombinant Human SLC25A37 protein is then purified using various chromatography techniques to obtain a highly pure and active protein.

Activity of Recombinant Human SLC25A37 Protein

The primary function of Human SLC25A37 protein is to transport glutamate across the mitochondrial inner membrane. This transport is essential for the production of ATP, the energy currency of the cell. Additionally, this protein has been shown to interact with other mitochondrial proteins, such as the ADP/ATP translocase, to regulate mitochondrial metabolism. The recombinant form of this protein has been extensively studied, and it has been shown to retain its transport activity, making it a valuable tool for studying mitochondrial metabolism and its role in disease.

Applications of Recombinant Human SLC25A37 Protein

Recombinant Human SLC25A37 protein has a wide range of applications in biomedical research, including drug discovery, disease modeling, and protein-protein interaction studies. One of the most significant applications of this protein is in the development of therapeutics for diseases related to mitochondrial dysfunction. Mutations in the SLC25A37 gene have been linked to various disorders, including mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS). By studying the activity and structure of recombinant Human SLC25A37 protein, researchers can gain insights into the molecular mechanisms underlying these diseases and develop targeted treatments.

Moreover, recombinant Human SLC25A37 protein has also been used as an antigen in immunological studies. Antibodies against this protein have been shown to be present in patients with autoimmune diseases, such as systemic lupus erythematosus, making it a potential biomarker for these conditions. Additionally, the recombinant form of this protein has been used to generate specific antibodies for use in diagnostic assays and as a tool for protein-protein interaction studies.

Conclusion

In conclusion, recombinant Human SLC25A37 protein is a versatile antigen with various applications in biomedical research. Its unique structure and activity make it an essential tool for studying mitochondrial metabolism and its role in disease. With ongoing research, this protein has the potential to lead to the development of targeted therapeutics for mitochondrial disorders and serve as a biomarker for autoimmune diseases. As the field of recombinant protein technology continues to advance, the potential applications of Human SLC25A37 protein are only expected to grow.

Recombinant Human SLC25A37 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human SLC25A37 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products