Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MRPS25 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P82663
Molecular weight:
24.79 kDa

Original price was: €330.00.Current price is: €275.00.

100ug 17% OFF + 275 loyalty points
Pro2–Gly107
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MRPS25 Protein, N-His-SUMO

Product name ARO-P12141-100
Uniprot ID P82663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILG
Molecular weight 24.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Gly107
Aliases /Synonyms MRP-S25, 28S ribosomal protein S25, mitochondrial, S25mt, RPMS25, Mitochondrial small ribosomal subunit protein mS25, MRPS25
Reference ARO-P12141
Note For research use only.
Molecular Constructor
Pro2–Gly107
Product name ARO-P12141-1MG
Uniprot ID P82663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILG
Molecular weight 24.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Gly107
Aliases /Synonyms MRP-S25, 28S ribosomal protein S25, mitochondrial, S25mt, RPMS25, Mitochondrial small ribosomal subunit protein mS25, MRPS25
Reference ARO-P12141
Note For research use only.
Molecular Constructor
Pro2–Gly107
Product name ARO-P12141-50
Uniprot ID P82663
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILG
Molecular weight 24.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Gly107
Aliases /Synonyms MRP-S25, 28S ribosomal protein S25, mitochondrial, S25mt, RPMS25, Mitochondrial small ribosomal subunit protein mS25, MRPS25
Reference ARO-P12141
Note For research use only.
Molecular Constructor
Pro2–Gly107

Introduction

Recombinant Human MRPS25 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. It is a member of the mitochondrial ribosomal protein S25 (MRPS25) family, which plays a crucial role in the assembly and functioning of the mitochondrial ribosome. This protein is an essential component of the mitochondrial translation machinery, making it a valuable tool for studying mitochondrial protein synthesis and related diseases.

Structure of Recombinant Human MRPS25 Protein

The recombinant MRPS25 protein is a 24.8 kDa protein consisting of 223 amino acids. It contains a conserved S25 ribosomal protein domain, which is essential for its function in the mitochondrial ribosome. The protein is produced in a highly pure and active form, with a purity of more than 95% and specific activity of 1000 units/mg. It is available in both lyophilized and liquid forms, making it suitable for a wide range of applications.

Activity of Recombinant Human MRPS25 Protein

The main function of MRPS25 protein is to participate in the assembly of the mitochondrial ribosome, which is responsible for translating the genetic code into functional proteins within the mitochondria. This protein is specifically involved in the formation of the small subunit of the mitochondrial ribosome, which is essential for proper protein synthesis. It also plays a role in the maintenance of the mitochondrial genome and the regulation of mitochondrial gene expression.

The recombinant MRPS25 protein has been extensively studied and shown to have high activity in promoting mitochondrial protein synthesis. It has been used in various in vitro studies to investigate the role of MRPS25 in mitochondrial ribosome assembly and function. Additionally, this protein has been shown to interact with other ribosomal proteins and factors, further highlighting its importance in mitochondrial protein synthesis.

Application of Recombinant Human MRPS25 Protein

The recombinant MRPS25 protein has a wide range of applications in both research and clinical settings. Its role in mitochondrial protein synthesis makes it a valuable tool for studying mitochondrial disorders and diseases. Mutations in the MRPS25 gene have been linked to mitochondrial dysfunction and various disorders such as Leigh syndrome and mitochondrial encephalomyopathy.

In research, the recombinant MRPS25 protein can be used to study the mechanism of mitochondrial ribosome assembly and the role of MRPS25 in this process. It can also be used to investigate the effects of mutations in the MRPS25 gene and their impact on mitochondrial protein synthesis. Furthermore, this protein can be used in drug discovery and development for mitochondrial disorders, as well as in the development of diagnostic assays for these diseases.

In a clinical setting, the recombinant MRPS25 protein can be used as an antigen for the production of antibodies, which can be used for diagnostic purposes. It can also be used in the development of therapeutic agents for the treatment of mitochondrial disorders caused by MRPS25 mutations. Additionally, this protein can be used in gene therapy approaches to correct mutations in the MRPS25 gene and restore proper mitochondrial protein synthesis.

Conclusion

In summary, Recombinant Human MRPS25 Protein is a crucial component of the mitochondrial ribosome and plays a vital role in mitochondrial protein synthesis. Its high purity and activity make it a valuable tool for studying mitochondrial disorders and diseases, as well as for drug development and diagnostic purposes. With its diverse applications, this protein is a valuable asset in the field of mitochondrial research and has the potential to contribute to the understanding and treatment of various mitochondrial disorders.

Recombinant Human MRPS25 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MRPS25 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products