Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC17A5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRA2
Molecular weight:
33.19 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Val65–Gln108
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC17A5 Protein, N-GST & C-His

Product name ARO-P10670-100
Uniprot ID Q9NRA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQ
Molecular weight 33.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val65-Gln108
Aliases /Synonyms H(+)/sialic acid cotransporter, H(+)/nitrate cotransporter, Sialin, AST, Vesicular H(+)/Aspartate-glutamate cotransporter, SLC17A5, Membrane glycoprotein HP59, Solute carrier family 17 member 5
Reference ARO-P10670
Note For research use only.
Molecular Constructor
Val65–Gln108
Product name ARO-P10670-1MG
Uniprot ID Q9NRA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQ
Molecular weight 33.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val65-Gln108
Aliases /Synonyms H(+)/sialic acid cotransporter, H(+)/nitrate cotransporter, Sialin, AST, Vesicular H(+)/Aspartate-glutamate cotransporter, SLC17A5, Membrane glycoprotein HP59, Solute carrier family 17 member 5
Reference ARO-P10670
Note For research use only.
Molecular Constructor
Val65–Gln108
Product name ARO-P10670-50
Uniprot ID Q9NRA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQ
Molecular weight 33.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val65-Gln108
Aliases /Synonyms H(+)/sialic acid cotransporter, H(+)/nitrate cotransporter, Sialin, AST, Vesicular H(+)/Aspartate-glutamate cotransporter, SLC17A5, Membrane glycoprotein HP59, Solute carrier family 17 member 5
Reference ARO-P10670
Note For research use only.
Molecular Constructor
Val65–Gln108

Introduction

Recombinant Human SLC17A5 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein is a member of the solute carrier family 17 (SLC17) and is also known as the sodium-dependent phosphate transport protein 3 (NPT3). It plays a crucial role in the transport of inorganic phosphate across cell membranes, making it an essential protein for various physiological processes.

Structure of Recombinant Human SLC17A5 Protein

The recombinant protein is composed of 492 amino acids and has a molecular weight of approximately 54 kDa. It contains 12 transmembrane domains and two cytoplasmic domains, with a predicted glycosylation site at position 147. The protein has a high degree of homology with other members of the SLC17 family, particularly with SLC17A3 and SLC17A4. The recombinant protein is expressed in mammalian cells and undergoes proper post-translational modifications, resulting in a fully functional protein with native-like structure and activity.

Activity of Recombinant Human SLC17A5 Protein

Recombinant Human SLC17A5 Protein functions as a sodium-dependent phosphate transporter, specifically transporting inorganic phosphate (Pi) across cell membranes. This process is crucial for maintaining cellular phosphate homeostasis, as Pi is an essential component for various biochemical reactions, including energy metabolism, nucleic acid synthesis, and cell signaling. The activity of this protein is regulated by the concentration of extracellular Pi and is also influenced by hormones such as parathyroid hormone and fibroblast growth factor 23.

Applications of Recombinant Human SLC17A5 Protein

Recombinant Human SLC17A5 Protein has various applications in both research and clinical settings. Some of the key applications include:

  • Study of phosphate transport: The recombinant protein can be used to study the mechanism of phosphate transport and its regulation in different cell types. It can also be used to investigate the role of SLC17A5 mutations in diseases associated with phosphate imbalance, such as hypophosphatemic rickets and nephrolithiasis.
  • Production of antibodies: Recombinant Human SLC17A5 Protein can be used as an antigen to produce specific antibodies against the protein. These antibodies can then be used in various immunoassays, such as ELISA and Western blot, to detect and quantify the protein in biological samples.
  • Development of therapeutics: SLC17A5 mutations have been linked to several inherited disorders, including sialic acid storage diseases. The recombinant protein can be used to screen for potential therapeutic agents that can modulate the activity of SLC17A5 and treat these diseases.

Conclusion

Recombinant Human SLC17A5 Protein is a crucial protein involved in the transport of inorganic phosphate across cell membranes. It is produced through recombinant DNA technology and has a native-like structure and activity. The protein has various applications in research and clinical settings, making it an essential tool for studying phosphate transport and related diseases.

Recombinant Human SLC17A5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human SLC17A5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products