Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SNAP29 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95721
Molecular weight:
23.03 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Gly34–Gly117
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SNAP29 Protein, N-His-SUMO & C-Strep

Product name ARO-P12383-100
Uniprot ID O95721
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFG
Molecular weight 23.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly117
Aliases /Synonyms SNAP-29, SNAP29, Vesicle-membrane fusion protein SNAP-29, Synaptosomal-associated protein 29, Soluble 29 kDa NSF attachment protein
Reference ARO-P12383
Note For research use only.
Molecular Constructor
Gly34–Gly117
Product name ARO-P12383-1MG
Uniprot ID O95721
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFG
Molecular weight 23.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly117
Aliases /Synonyms SNAP-29, SNAP29, Vesicle-membrane fusion protein SNAP-29, Synaptosomal-associated protein 29, Soluble 29 kDa NSF attachment protein
Reference ARO-P12383
Note For research use only.
Molecular Constructor
Gly34–Gly117
Product name ARO-P12383-50
Uniprot ID O95721
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFG
Molecular weight 23.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly117
Aliases /Synonyms SNAP-29, SNAP29, Vesicle-membrane fusion protein SNAP-29, Synaptosomal-associated protein 29, Soluble 29 kDa NSF attachment protein
Reference ARO-P12383
Note For research use only.
Molecular Constructor
Gly34–Gly117

Introduction

Recombinant Human SNAP29 Protein, also known as Synaptosomal-associated protein 29, is a crucial protein involved in the process of vesicle fusion in the cell. It is a 29 kDa protein that is encoded by the SNAP29 gene and is highly conserved among different species. This protein plays a vital role in the intracellular trafficking of proteins and is involved in various cellular processes such as secretion, endocytosis, and exocytosis. In this article, we will discuss the structure, activity, and applications of Recombinant Human SNAP29 Protein.

Structure of Recombinant Human SNAP29 Protein

The SNAP29 protein is composed of 247 amino acids and has a molecular weight of 29 kDa. It contains a coiled-coil domain at the N-terminus and a SNARE motif at the C-terminus. The coiled-coil domain is responsible for protein-protein interactions, while the SNARE motif is involved in membrane fusion. The SNAP29 protein also has a hydrophobic region that helps in anchoring it to the membrane.

The recombinant form of SNAP29 protein is produced by cloning the SNAP29 gene into an expression vector and expressing it in a suitable host cell. This allows for the production of large quantities of pure and active protein for various research and therapeutic applications.

Activity of Recombinant Human SNAP29 Protein

The main function of SNAP29 protein is to mediate the fusion of vesicles with the target membrane. This process is crucial for the transport of proteins and other molecules within the cell and for the secretion of substances outside the cell. The SNAP29 protein acts as a t-SNARE (target SNARE) and forms a complex with v-SNAREs (vesicle SNAREs) present on the vesicle membrane. This complex then interacts with other proteins to facilitate the fusion of the vesicle with the target membrane.

Apart from its role in vesicle fusion, the SNAP29 protein is also involved in the regulation of endocytosis and exocytosis. It has been shown to interact with various proteins involved in these processes, such as clathrin and dynamin. This suggests that SNAP29 protein may play a broader role in intracellular trafficking and cellular communication.

Applications of Recombinant Human SNAP29 Protein

The recombinant form of SNAP29 protein has various applications in both research and therapeutic settings. Some of the key applications include:

1. Studying intracellular trafficking

Recombinant SNAP29 protein can be used to study the mechanisms of intracellular trafficking and vesicle fusion. By manipulating the levels of SNAP29 protein in cells, researchers can gain insights into its role in various cellular processes and identify potential targets for drug development.

2. Developing therapies for neurological disorders

SNAP29 protein has been linked to various neurological disorders, including schizophrenia and autism. Recombinant SNAP29 protein can be used to study the molecular basis of these disorders and develop targeted therapies to treat them.

3. Production of antibodies

The SNAP29 protein is an antigen, meaning it can elicit an immune response in the body. Recombinant SNAP29 protein can be used to produce specific antibodies that can be used in various research and diagnostic applications.

4. Protein-protein interaction studies

The coiled-coil domain of SNAP29 protein is involved in protein-protein interactions. Recombinant SNAP29 protein can be used to study these interactions and identify potential binding partners, which can provide valuable insights into the function of this protein.

5. Drug screening

Recombinant SNAP29 protein can be used in high-throughput drug screening assays to identify potential compounds that can modulate its activity. This can aid in the development of

Recombinant Human SNAP29 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human SNAP29 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products