Brand: ProteoGenix

Recombinant Human MYCN Protein, N-His-SUMO & C-Strep

ARO-P12389-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: P04198
Molecular weight:: 23.71 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points

Asp48–Arg138

Size Size

50ug Original price was: €294.00.Current price is: €230.00.
100ug Original price was: €372.00.Current price is: €329.00.
1MG Original price was: €1,068.00.Current price is: €954.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Recombinant Human MYCN Protein, N-His-SUMO & C-Strep

Product name	ARO-P12389-100
Uniprot ID	P04198
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	DIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGR
Molecular weight	23.71 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Asp48-Arg138
Aliases /Synonyms	BHLHE37, bHLHe37, Class E basic helix-loop-helix protein 37, N-myc proto-oncogene protein, MYCN, NMYC
Reference	ARO-P12389
Note	For research use only.
Molecular Constructor	Asp48–Arg138

Product name	ARO-P12389-1MG
Uniprot ID	P04198
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	DIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGR
Molecular weight	23.71 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Asp48-Arg138
Aliases /Synonyms	BHLHE37, bHLHe37, Class E basic helix-loop-helix protein 37, N-myc proto-oncogene protein, MYCN, NMYC
Reference	ARO-P12389
Note	For research use only.
Molecular Constructor	Asp48–Arg138

Product name	ARO-P12389-50
Uniprot ID	P04198
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	DIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGR
Molecular weight	23.71 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Asp48-Arg138
Aliases /Synonyms	BHLHE37, bHLHe37, Class E basic helix-loop-helix protein 37, N-myc proto-oncogene protein, MYCN, NMYC
Reference	ARO-P12389
Note	For research use only.
Molecular Constructor	Asp48–Arg138