Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SEM1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P60896
Molecular weight:
21.77 kDa

Original price was: €226.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Ser2–Ser70
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SEM1 Protein, N-His-SUMO & C-Strep

Product name ARO-P10766-100
Uniprot ID P60896
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
Molecular weight 21.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser70
Aliases /Synonyms Split hand/foot malformation type 1 protein, Deleted in split hand/split foot protein 1, DSS1, SHFDG1, SHFM1, Split hand/foot deleted protein 1, C7orf76, 26S proteasome complex subunit SEM1, SEM1, 26S proteasome complex subunit DSS1
Reference ARO-P10766
Note For research use only.
Molecular Constructor
Ser2–Ser70
Product name ARO-P10766-1MG
Uniprot ID P60896
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
Molecular weight 21.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser70
Aliases /Synonyms Split hand/foot malformation type 1 protein, Deleted in split hand/split foot protein 1, DSS1, SHFDG1, SHFM1, Split hand/foot deleted protein 1, C7orf76, 26S proteasome complex subunit SEM1, SEM1, 26S proteasome complex subunit DSS1
Reference ARO-P10766
Note For research use only.
Molecular Constructor
Ser2–Ser70
Product name ARO-P10766-50
Uniprot ID P60896
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
Molecular weight 21.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser70
Aliases /Synonyms Split hand/foot malformation type 1 protein, Deleted in split hand/split foot protein 1, DSS1, SHFDG1, SHFM1, Split hand/foot deleted protein 1, C7orf76, 26S proteasome complex subunit SEM1, SEM1, 26S proteasome complex subunit DSS1
Reference ARO-P10766
Note For research use only.
Molecular Constructor
Ser2–Ser70

Introduction

Recombinant Human SEM1 Protein, also known as Semenogelin-1, is a protein that is encoded by the SEMG1 gene in humans. This protein is a member of the semenogelin family and is primarily found in the seminal vesicles, where it plays a crucial role in semen coagulation and sperm motility. In this article, we will explore the structure, activity, and applications of Recombinant Human SEM1 Protein.

Structure of Recombinant Human SEM1 Protein

Recombinant Human SEM1 Protein is a 306 amino acid protein with a molecular weight of approximately 34 kDa. It is composed of two major domains: a central region containing a high number of cysteine residues and a C-terminal domain rich in proline and glycine. These domains are important for the protein’s function in semen coagulation and sperm motility.

The crystal structure of Recombinant Human SEM1 Protein has been determined, revealing a dimeric structure with a central coiled-coil domain and two globular domains at the ends. This structure is essential for the protein’s ability to interact with other proteins and form a stable coagulum in semen.

Activity of Recombinant Human SEM1 Protein

The primary function of Recombinant Human SEM1 Protein is to promote semen coagulation. During ejaculation, this protein is secreted by the seminal vesicles and interacts with other proteins in semen to form a coagulum. This coagulum helps to keep the sperm in place and protect them from the acidic environment of the female reproductive tract.

In addition to its role in semen coagulation, Recombinant Human SEM1 Protein also plays a crucial role in sperm motility. It has been shown to bind to the surface of sperm cells and facilitate their movement. This activity is essential for successful fertilization and reproduction.

Applications of Recombinant Human SEM1 Protein

Recombinant Human SEM1 Protein has various applications in both research and clinical settings. One of the main uses of this protein is in the study of semen coagulation and male fertility. Researchers can use Recombinant Human SEM1 Protein to understand the mechanisms of semen coagulation and its role in male fertility.

In clinical settings, Recombinant Human SEM1 Protein has been used in diagnostic tests for male infertility. Abnormal levels of this protein in semen can indicate issues with semen coagulation and sperm motility, which can affect fertility. Additionally, Recombinant Human SEM1 Protein has also been investigated as a potential biomarker for prostate cancer.

Furthermore, Recombinant Human SEM1 Protein has potential therapeutic applications. Studies have shown that this protein can inhibit the growth of certain bacteria and viruses, making it a potential candidate for the development of new antimicrobial agents.

Conclusion

In summary, Recombinant Human SEM1 Protein is a crucial protein involved in semen coagulation and sperm motility. Its unique structure and activity make it an essential component of male fertility and reproductive health. With its various applications in research and clinical settings, Recombinant Human SEM1 Protein continues to be a valuable tool for understanding and treating male reproductive disorders.

Recombinant Human SEM1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human SEM1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products