Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human S100A16, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96FQ6
Molecular weight:
13.98 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Ser2–Ser103
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human S100A16, N-His

Product name ARO-P13179-100
Uniprot ID Q96FQ6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Molecular weight 13.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser103
Aliases /Synonyms S100A16, Aging-associated gene 13 protein, Protein S100-A16, S100 calcium-binding protein A16, S100F, Protein S100-F
Reference ARO-P13179
Note For research use only.
Molecular Constructor
Ser2–Ser103
Product name ARO-P13179-1MG
Uniprot ID Q96FQ6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Molecular weight 13.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser103
Aliases /Synonyms S100A16, Aging-associated gene 13 protein, Protein S100-A16, S100 calcium-binding protein A16, S100F, Protein S100-F
Reference ARO-P13179
Note For research use only.
Molecular Constructor
Ser2–Ser103
Product name ARO-P13179-50
Uniprot ID Q96FQ6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Molecular weight 13.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser103
Aliases /Synonyms S100A16, Aging-associated gene 13 protein, Protein S100-A16, S100 calcium-binding protein A16, S100F, Protein S100-F
Reference ARO-P13179
Note For research use only.
Molecular Constructor
Ser2–Ser103

Introduction to Recombinant Human S100A16

Recombinant Human S100A16 is a protein that belongs to the S100 family of calcium-binding proteins. It is encoded by the S100A16 gene and is expressed in various tissues, including the heart, liver, and brain. This protein has been found to have important roles in cellular processes such as cell growth, differentiation, and apoptosis. In this article, we will explore the structure, activity, and applications of Recombinant Human S100A16.

Structure of Recombinant Human S100A16

Recombinant Human S100A16 is a small protein with a molecular weight of approximately 10 kDa. It is composed of 91 amino acids and has a conserved EF-hand calcium-binding domain. This domain is responsible for the calcium-dependent conformational changes that are crucial for the activity of S100 proteins. The structure of Recombinant Human S100A16 also includes a C-terminal extension that is unique to this protein and is involved in its cellular localization and function.

Activity of Recombinant Human S100A16

Recombinant Human S100A16 has been shown to have a diverse range of activities in different cellular processes. One of its main functions is its role in regulating cell growth and proliferation. Studies have shown that this protein can stimulate cell proliferation in certain types of cancer cells, such as breast cancer and colon cancer. It achieves this by interacting with other proteins and signaling pathways involved in cell growth and division.

In addition to its role in cell growth, Recombinant Human S100A16 has also been found to be involved in cell differentiation. It has been shown to promote the differentiation of osteoblasts, which are cells responsible for bone formation. This suggests that this protein may have potential applications in bone regeneration and repair.

Recombinant Human S100A16 has also been linked to the process of apoptosis, or programmed cell death. It has been found to interact with proteins involved in apoptosis, such as Bcl-2 and caspases, and may play a role in regulating this process. This suggests that this protein may have potential applications in cancer therapy by promoting cell death in cancer cells.

Applications of Recombinant Human S100A16

Due to its diverse range of activities, Recombinant Human S100A16 has potential applications in various fields, including cancer research, tissue engineering, and drug development. Its role in promoting cell proliferation and differentiation makes it a potential target for cancer therapy and bone regeneration. It can also be used as a biomarker for certain types of cancer, as its expression has been found to be upregulated in breast and colon cancer cells.

Furthermore, Recombinant Human S100A16 has been investigated as a potential therapeutic target for other diseases, such as diabetes and neurodegenerative disorders. It has been found to play a role in insulin secretion and glucose metabolism, and its expression has been linked to Alzheimer’s disease and Parkinson’s disease. This suggests that this protein may have potential applications in the treatment of these conditions.

Conclusion

In summary, Recombinant Human S100A16 is a small protein with a conserved EF-hand calcium-binding domain and a unique C-terminal extension. It has been found to have diverse activities in regulating cell growth, differentiation, and apoptosis. Its potential applications in cancer therapy, tissue engineering, and drug development make it a promising target for further research and development. With ongoing studies and advancements in recombinant protein technology, Recombinant Human S100A16 may hold great potential for future therapeutic interventions.

Recombinant Human S100A16, N-His

There are no reviews yet.

Be the first to review “Recombinant Human S100A16, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products