Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SUZ12 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15022
Molecular weight:
14.77 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Lys587–Gly691
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SUZ12 Protein, N-His

Product name ARO-P11405-100
Uniprot ID Q15022
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKG
Molecular weight 14.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys587-Gly691
Aliases /Synonyms SUZ12, Polycomb protein SUZ12, Joined to JAZF1 protein, CHET9, KIAA0160, ChET 9 protein, Suppressor of zeste 12 protein homolog, Chromatin precipitated E2F target 9 protein, JJAZ1
Reference ARO-P11405
Note For research use only.
Molecular Constructor
Lys587–Gly691
Product name ARO-P11405-1MG
Uniprot ID Q15022
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKG
Molecular weight 14.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys587-Gly691
Aliases /Synonyms SUZ12, Polycomb protein SUZ12, Joined to JAZF1 protein, CHET9, KIAA0160, ChET 9 protein, Suppressor of zeste 12 protein homolog, Chromatin precipitated E2F target 9 protein, JJAZ1
Reference ARO-P11405
Note For research use only.
Molecular Constructor
Lys587–Gly691
Product name ARO-P11405-50
Uniprot ID Q15022
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKG
Molecular weight 14.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys587-Gly691
Aliases /Synonyms SUZ12, Polycomb protein SUZ12, Joined to JAZF1 protein, CHET9, KIAA0160, ChET 9 protein, Suppressor of zeste 12 protein homolog, Chromatin precipitated E2F target 9 protein, JJAZ1
Reference ARO-P11405
Note For research use only.
Molecular Constructor
Lys587–Gly691

Introduction

Recombinant Human SUZ12 Protein is a protein that plays a crucial role in gene regulation and development. It is a key component of the Polycomb Repressive Complex 2 (PRC2), which is responsible for epigenetic silencing of target genes. This protein is produced through recombinant DNA technology, making it a valuable tool for research and therapeutic applications.

Structure of Recombinant Human SUZ12 Protein

The SUZ12 protein is composed of 739 amino acids and has a molecular weight of approximately 83 kDa. It contains a highly conserved zinc finger domain at its N-terminus, which is responsible for binding to histone proteins. The C-terminal region of the protein contains a SET domain, which is involved in histone methyltransferase activity.

The recombinant version of SUZ12 is produced by inserting the gene encoding for the protein into a suitable expression vector, such as a bacterial or mammalian cell system. This allows for the production of large quantities of the protein in a controlled environment.

Activity of Recombinant Human SUZ12 Protein

The main function of SUZ12 is to act as a core component of the PRC2 complex, which is responsible for adding methyl groups to specific histone proteins. This process, known as histone methylation, leads to the silencing of target genes by altering the chromatin structure. SUZ12 is specifically responsible for recognizing and binding to specific DNA sequences, allowing for targeted gene regulation.

In addition to its role in gene regulation, SUZ12 has also been found to play a role in cell differentiation and development. It is essential for the proper development of various tissues and organs, including the central nervous system and the immune system.

Applications of Recombinant Human SUZ12 Protein

The availability of recombinant SUZ12 protein has opened up new avenues for research in the fields of epigenetics and gene regulation. Its ability to specifically target and silence genes has made it a valuable tool for studying the role of specific genes in various biological processes.

Furthermore, the dysregulation of SUZ12 has been linked to various diseases, including cancer. Therefore, recombinant SUZ12 protein has potential applications in the development of targeted therapies for these diseases. It can also be used in drug discovery and screening assays to identify compounds that can modulate the activity of SUZ12.

Conclusion

Recombinant Human SUZ12 Protein is a crucial component of the PRC2 complex, involved in gene regulation and development. Its structure and activity make it a valuable tool for research in the fields of epigenetics and gene regulation. Furthermore, its potential applications in disease treatment and drug discovery make it a promising target for future studies. With the advancement of recombinant DNA technology, the production and use of this protein will continue to contribute to our understanding of gene regulation and its role in various biological processes.

Keywords:

Recombinant protein, antigen, SUZ12, Polycomb Repressive Complex 2, epigenetics, gene regulation, histone methylation, drug discovery, cancer, development.

Recombinant Human SUZ12 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SUZ12 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products