Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RTRAF Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y224
Molecular weight:
26.31 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Phe2–Glu118
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RTRAF Protein, N-His-SUMO

Product name ARO-P10655-100
Uniprot ID Q9Y224
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAE
Molecular weight 26.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe2-Glu118
Aliases /Synonyms CLE, CLE7 homolog, hCLE, RTRAF, RNA transcription, translation and transport factor protein, C14orf166
Reference ARO-P10655
Note For research use only.
Molecular Constructor
Phe2–Glu118
Product name ARO-P10655-1MG
Uniprot ID Q9Y224
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAE
Molecular weight 26.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe2-Glu118
Aliases /Synonyms CLE, CLE7 homolog, hCLE, RTRAF, RNA transcription, translation and transport factor protein, C14orf166
Reference ARO-P10655
Note For research use only.
Molecular Constructor
Phe2–Glu118
Product name ARO-P10655-50
Uniprot ID Q9Y224
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAE
Molecular weight 26.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe2-Glu118
Aliases /Synonyms CLE, CLE7 homolog, hCLE, RTRAF, RNA transcription, translation and transport factor protein, C14orf166
Reference ARO-P10655
Note For research use only.
Molecular Constructor
Phe2–Glu118

Introduction

Recombinant Human RTRAF Protein, also known as Recombinant Tumor Necrosis Factor Receptor-Associated Factor, is a type of protein that is commonly used in scientific research and medical applications. This protein is produced through the process of genetic engineering, where the gene responsible for producing this protein is inserted into host cells, allowing for the production of large quantities of the protein. In this article, we will discuss the structure, activity, and applications of Recombinant Human RTRAF Protein.

Structure of Recombinant Human RTRAF Protein

The structure of Recombinant Human RTRAF Protein is composed of 596 amino acids and has a molecular weight of approximately 66 kDa. It is a member of the tumor necrosis factor receptor-associated factor (TRAF) family of proteins, which are known to play a crucial role in various cellular processes such as cell survival, proliferation, and immune response. The protein contains several domains, including a RING finger domain, a TRAF domain, and a zinc finger domain, which are responsible for its specific functions.

Activity of Recombinant Human RTRAF Protein

Recombinant Human RTRAF Protein is primarily known for its ability to interact with other proteins and regulate various signaling pathways within the cell. It is a key component of the NF-κB signaling pathway, which is responsible for regulating the expression of genes involved in immune response and inflammation. The protein also plays a role in the activation of the JNK and MAPK signaling pathways, which are involved in cell growth, differentiation, and apoptosis.

Applications of Recombinant Human RTRAF Protein

Recombinant Human RTRAF Protein has a wide range of applications in both research and medical fields. One of its main uses is in the study of various signaling pathways and their role in cellular processes. The protein is also used in the development of new drugs and therapies for diseases such as cancer and autoimmune disorders.

In cancer research, Recombinant Human RTRAF Protein is used to study the role of the NF-κB signaling pathway in tumor growth and metastasis. It has been found that this protein plays a crucial role in regulating the expression of genes involved in cancer cell survival and proliferation. Therefore, targeting this protein could potentially lead to the development of new cancer treatments.

In addition to cancer, Recombinant Human RTRAF Protein has also been studied for its potential role in autoimmune disorders. It has been found that this protein is involved in the regulation of the immune response, and dysregulation of its activity has been linked to various autoimmune diseases. By targeting this protein, researchers hope to develop new treatments for these conditions.

Recombinant Human RTRAF Protein has also been used in the development of diagnostic tools for various diseases. For example, it has been used as an antigen in immunoassays to detect the presence of specific antibodies in patient samples. This has proven to be a valuable tool in the diagnosis of diseases such as rheumatoid arthritis and lupus.

Conclusion

In summary, Recombinant Human RTRAF Protein is a key player in various cellular processes and has a wide range of applications in research and medicine. Its unique structure and activity make it an essential tool in the study of signaling pathways and the development of new treatments for diseases such as cancer and autoimmune disorders. As research continues, the potential uses of this protein are likely to expand, making it a valuable asset in the scientific community.

Recombinant Human RTRAF Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human RTRAF Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products