Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CYGB, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WWM9
Molecular weight:
23.71 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Met1–Pro190
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CYGB, N-His

Product name ARO-P13219-100
Uniprot ID Q8WWM9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro190
Aliases /Synonyms Histoglobin, CYGB, Stellate cell activation-associated protein, Cytoglobin, STAP, HGb
Reference ARO-P13219
Note For research use only.
Molecular Constructor
Met1–Pro190
Product name ARO-P13219-1MG
Uniprot ID Q8WWM9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro190
Aliases /Synonyms Histoglobin, CYGB, Stellate cell activation-associated protein, Cytoglobin, STAP, HGb
Reference ARO-P13219
Note For research use only.
Molecular Constructor
Met1–Pro190
Product name ARO-P13219-50
Uniprot ID Q8WWM9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro190
Aliases /Synonyms Histoglobin, CYGB, Stellate cell activation-associated protein, Cytoglobin, STAP, HGb
Reference ARO-P13219
Note For research use only.
Molecular Constructor
Met1–Pro190

Title: Introduction to Recombinant Human CYGB

Recombinant human CYGB (Cytoglobin) is a protein that belongs to the globin family and is encoded by the CYGB gene. It is a heme-containing protein that is highly conserved among different species, including humans, mice, and zebrafish. CYGB is primarily expressed in tissues with high oxygen consumption, such as the heart, lungs, and skeletal muscles. In recent years, there has been a growing interest in studying the structure, activity, and potential applications of recombinant human CYGB.

Structure of Recombinant Human CYGB

The human CYGB protein consists of 190 amino acids and has a molecular weight of approximately 21 kDa. It contains a heme-binding pocket that is essential for its function. The structure of CYGB is similar to that of other globins, such as hemoglobin and myoglobin, with a globular fold and eight alpha-helices. However, CYGB has a unique heme pocket that is more exposed, allowing for easier access to oxygen.

Activity of Recombinant Human CYGB

The primary function of CYGB is to facilitate oxygen transport and storage in tissues with high metabolic demands. It has been shown to bind both oxygen and carbon monoxide, with a higher affinity for the latter. This binding of carbon monoxide to CYGB has been suggested to play a role in protecting cells from oxidative stress. Additionally, CYGB has been found to have antioxidant properties, helping to reduce the levels of reactive oxygen species in cells.

Recombinant human CYGB has also been shown to have a role in regulating cell growth and proliferation. Studies have demonstrated that CYGB can inhibit cell proliferation and promote cell death in cancer cells. This suggests that CYGB may have potential therapeutic applications in cancer treatment.

Application of Recombinant Human CYGB

The unique properties and functions of recombinant human CYGB make it a promising candidate for various applications in the fields of medicine and biotechnology. One potential application is in the treatment of diseases related to oxidative stress, such as cardiovascular diseases and neurodegenerative disorders. CYGB’s ability to bind carbon monoxide and reduce oxidative stress could be harnessed for therapeutic purposes.

Another potential application of recombinant human CYGB is in cancer treatment. As mentioned earlier, CYGB has been shown to inhibit cell proliferation and promote cell death in cancer cells. This makes it a potential target for cancer therapies, either as a standalone treatment or in combination with other therapies.

Moreover, recombinant human CYGB has also been studied for its potential use in tissue engineering. Its ability to promote cell death and regulate cell growth could be utilized in developing artificial tissues and organs.

Conclusion

In conclusion, recombinant human CYGB is a highly conserved protein with a unique structure and multiple functions. Its role in oxygen transport, antioxidant activity, and cell regulation make it a promising candidate for various applications in medicine and biotechnology. Further research and development of recombinant human CYGB could potentially lead to new and innovative treatments for various diseases and disorders.

Recombinant Human CYGB, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CYGB, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products