Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HMGB4, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WW32
Molecular weight:
19.62 kDa

Original price was: €311.00.Current price is: €275.00.

100ug 12% OFF + 275 loyalty points
Asn25–Arg167
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HMGB4, N-His

Product name ARO-P13221-100
Uniprot ID Q8WW32
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNAR
Molecular weight 19.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn25-Arg167
Aliases /Synonyms HMGB4, High mobility group protein B4
Reference ARO-P13221
Note For research use only.
Molecular Constructor
Asn25–Arg167
Product name ARO-P13221-1MG
Uniprot ID Q8WW32
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNAR
Molecular weight 19.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn25-Arg167
Aliases /Synonyms HMGB4, High mobility group protein B4
Reference ARO-P13221
Note For research use only.
Molecular Constructor
Asn25–Arg167
Product name ARO-P13221-50
Uniprot ID Q8WW32
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNAR
Molecular weight 19.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn25-Arg167
Aliases /Synonyms HMGB4, High mobility group protein B4
Reference ARO-P13221
Note For research use only.
Molecular Constructor
Asn25–Arg167

Introduction

Recombinant Human HMGB4 is a protein that has been engineered in the laboratory using recombinant DNA technology. This technology involves inserting the gene for HMGB4 into a host cell, such as bacteria or yeast, and allowing the cell to produce large quantities of the protein. Recombinant Human HMGB4 has gained significant attention in the scientific community due to its unique structure, diverse activities, and potential applications.

Structure of Recombinant Human HMGB4

Recombinant Human HMGB4 is a member of the High Mobility Group Box (HMGB) protein family, which consists of four proteins (HMGB1-4) that share a similar structure and function. The HMGB proteins are characterized by two DNA-binding domains, known as HMG boxes, which are connected by a flexible linker region. HMGB4 is a small protein, consisting of 164 amino acids, and has a molecular weight of approximately 18 kDa.

Activity of Recombinant Human HMGB4

Recombinant Human HMGB4 has been shown to have multiple activities, including DNA binding, chromatin remodeling, and regulation of gene expression. The protein has a high affinity for DNA and can bind to both double-stranded and single-stranded DNA. This binding is mediated by the HMG boxes, which interact with the minor groove of the DNA helix. Additionally, HMGB4 has been found to play a role in regulating the structure and function of chromatin, which is the complex of DNA and proteins in the nucleus of a cell. This activity is important for the proper functioning of genes and can impact various cellular processes.

Application of Recombinant Human HMGB4

The unique structure and diverse activities of Recombinant Human HMGB4 make it a valuable tool in various scientific applications. One of the major applications of HMGB4 is in the field of gene regulation and expression. Due to its ability to bind to DNA and regulate chromatin structure, HMGB4 can potentially be used to modulate gene expression and understand the underlying mechanisms of gene regulation.

Additionally, Recombinant Human HMGB4 has been studied for its potential role in cancer. It has been found to be overexpressed in various types of cancer, and its expression has been linked to tumor growth and metastasis. Therefore, targeting HMGB4 with specific inhibitors or antibodies could potentially be a therapeutic strategy for cancer treatment.

Furthermore, HMGB4 has also been investigated for its role in inflammation and immune response. It has been shown to interact with various immune cells and cytokines, suggesting its involvement in the regulation of immune response. This makes HMGB4 a potential target for developing new therapies for inflammatory diseases.

Conclusion

In conclusion, Recombinant Human HMGB4 is a unique protein with a diverse range of activities and potential applications. Its structure, DNA-binding ability, and role in gene regulation make it a valuable tool for studying various biological processes. Furthermore, its potential involvement in cancer and inflammation highlights the importance of further research on this protein. With ongoing studies and advancements in recombinant protein technology, the full potential of Recombinant Human HMGB4 is yet to be discovered.

Recombinant Human HMGB4, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HMGB4, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products