Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RPS8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P62241
Molecular weight:
21.80 kDa

Original price was: €267.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Arg41–Lys208
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RPS8 Protein, N-His

Product name ARO-P10762-100
Uniprot ID P62241
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK
Molecular weight 21.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg41-Lys208
Aliases /Synonyms RPS8, Small ribosomal subunit protein eS8, 40S ribosomal protein S8
Reference ARO-P10762
Note For research use only.
Molecular Constructor
Arg41–Lys208
Product name ARO-P10762-1MG
Uniprot ID P62241
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK
Molecular weight 21.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg41-Lys208
Aliases /Synonyms RPS8, Small ribosomal subunit protein eS8, 40S ribosomal protein S8
Reference ARO-P10762
Note For research use only.
Molecular Constructor
Arg41–Lys208
Product name ARO-P10762-50
Uniprot ID P62241
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK
Molecular weight 21.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg41-Lys208
Aliases /Synonyms RPS8, Small ribosomal subunit protein eS8, 40S ribosomal protein S8
Reference ARO-P10762
Note For research use only.
Molecular Constructor
Arg41–Lys208

Introduction to Recombinant Human RPS8 Protein

Recombinant Human RPS8 Protein, also known as Ribosomal Protein S8, is a highly conserved protein that plays a crucial role in protein synthesis. It is a component of the small ribosomal subunit, which is responsible for decoding the genetic information present in messenger RNA (mRNA) and synthesizing proteins. The RPS8 gene is located on the long arm of chromosome 1 and is expressed in all tissues, making it a widely studied protein in the field of molecular biology.

Structure of Recombinant Human RPS8 Protein

The RPS8 protein is composed of 246 amino acids and has a molecular weight of 28 kDa. It has a conserved structure consisting of a central beta-sheet surrounded by alpha-helices, similar to other ribosomal proteins. The protein also contains two zinc-binding domains that are crucial for its function in the ribosome. Recombinant Human RPS8 Protein is produced using recombinant DNA technology, where the gene encoding RPS8 is inserted into an expression vector and then expressed in a suitable host cell, such as E. coli.

Activity of Recombinant Human RPS8 Protein

Recombinant Human RPS8 Protein is an essential component of the small ribosomal subunit, which is responsible for decoding the genetic code and synthesizing proteins. It plays a crucial role in the initiation of protein synthesis by binding to the 5’ end of mRNA and recruiting other ribosomal proteins. RPS8 also interacts with other proteins and RNA molecules within the ribosome, contributing to the overall stability and function of the ribosome. Additionally, RPS8 has been shown to have a role in regulating cell proliferation and apoptosis, making it a potential target for cancer research.

Application of Recombinant Human RPS8 Protein

Recombinant Human RPS8 Protein has a wide range of applications in both research and industrial settings. It is commonly used as an antigen in studies involving ribosome structure and function. The recombinant protein can be used to generate specific antibodies for immunological assays, such as ELISA and Western blotting, to study the expression and localization of RPS8 in different tissues and cell types.

In the pharmaceutical industry, Recombinant Human RPS8 Protein is used in the production of therapeutic proteins, such as insulin and growth factors, through recombinant protein expression systems. Its role in regulating cell growth and apoptosis also makes it a potential target for drug development in cancer treatment. Recombinant RPS8 can be used in high-throughput screening assays to identify small molecule inhibitors that can modulate its activity.

Furthermore, Recombinant Human RPS8 Protein has potential applications in agriculture, specifically in the production of genetically modified crops. By introducing the RPS8 gene into plants, it can enhance their protein synthesis machinery, leading to increased yield and quality of crops.

Conclusion

In conclusion, Recombinant Human RPS8 Protein is a highly conserved and essential component of the ribosome, with a crucial role in protein synthesis. Its structure, activity, and potential applications make it a valuable tool in various fields, including molecular biology, pharmaceuticals, and agriculture. With ongoing research and advancements in recombinant protein technology, the use of Recombinant Human RPS8 Protein is likely to continue to expand, contributing to a better understanding of protein synthesis and its applications.

Recombinant Human RPS8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RPS8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products