Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL2 Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P60568
Molecular weight:
16.48 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Met1–Thr134
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL2 Protein, C-His

Product name ARO-P10409-100
Uniprot ID P60568
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADE
Molecular weight 16.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr134
Aliases /Synonyms IL2, IL-2, Aldesleukin, Interleukin-2, TCGF, T-cell growth factor
Reference ARO-P10409
Note For research use only.
Molecular Constructor
Met1–Thr134
Product name ARO-P10409-1MG
Uniprot ID P60568
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADE
Molecular weight 16.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr134
Aliases /Synonyms IL2, IL-2, Aldesleukin, Interleukin-2, TCGF, T-cell growth factor
Reference ARO-P10409
Note For research use only.
Molecular Constructor
Met1–Thr134
Product name ARO-P10409-50
Uniprot ID P60568
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADE
Molecular weight 16.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr134
Aliases /Synonyms IL2, IL-2, Aldesleukin, Interleukin-2, TCGF, T-cell growth factor
Reference ARO-P10409
Note For research use only.
Molecular Constructor
Met1–Thr134

Introduction to Recombinant Human IL2 Protein

Recombinant Human IL2 Protein, also known as interleukin-2, is a cytokine protein that plays a crucial role in the immune system. It is produced by activated T cells and acts as a growth factor for various immune cells, including T cells, B cells, and natural killer cells. The recombinant form of this protein is produced through genetic engineering techniques and has been widely used in research and clinical applications. In this article, we will delve into the structure, activity, and applications of Recombinant Human IL2 Protein.

Structure of Recombinant Human IL2 Protein

Recombinant Human IL2 Protein is composed of 133 amino acids and has a molecular weight of approximately 15 kDa. It is a homodimer, meaning it consists of two identical subunits. Each subunit has a four-helix bundle structure and contains two disulfide bonds that are crucial for its stability. The protein also has a hydrophobic core that is responsible for its structural stability. Recombinant Human IL2 Protein is highly conserved among different species, with human and mouse IL2 proteins sharing 56% sequence identity.

Activity of Recombinant Human IL2 Protein

The main function of Recombinant Human IL2 Protein is to regulate the immune response. It acts as a growth factor for T cells, promoting their proliferation, differentiation, and survival. This cytokine also plays a crucial role in the activation and expansion of natural killer cells, which are essential for the body’s defense against viruses and tumors. Additionally, Recombinant Human IL2 Protein has been shown to enhance the activity of B cells, leading to increased antibody production. It also has anti-inflammatory properties and can modulate the activity of regulatory T cells, which are essential for maintaining immune tolerance.

Applications of Recombinant Human IL2 Protein

Recombinant Human IL2 Protein has a wide range of applications in both research and clinical settings. In research, it is commonly used as a growth factor to stimulate the proliferation of T cells in cell culture experiments. It is also used to expand the number of T cells in adoptive cell therapy, a promising immunotherapy approach for cancer treatment. Additionally, Recombinant Human IL2 Protein is used in studies to investigate the role of T cells in various diseases and to understand the mechanisms of immune response regulation.

In clinical applications, Recombinant Human IL2 Protein has been approved by the FDA for the treatment of metastatic renal cell carcinoma and metastatic melanoma. It is administered as an injection and works by activating and expanding the patient’s own immune cells to fight against cancer cells. This therapy has shown promising results in clinical trials and has been used as a second-line treatment for patients who have not responded to other therapies.

Conclusion

In summary, Recombinant Human IL2 Protein is a crucial cytokine in the immune system, with multiple functions in regulating the immune response. Its homodimeric structure and conserved sequence make it an ideal candidate for genetic engineering techniques, leading to the production of recombinant forms for research and clinical use. Its applications in cancer treatment and immunotherapy have shown promising results and continue to be an area of active research. With its diverse functions and potential therapeutic applications, Recombinant Human IL2 Protein remains a significant protein in the field of immunology.

Recombinant Human IL2 Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Human IL2 Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products