Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RNF2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99496
Molecular weight:
15.13 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Glu225–Lys336
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RNF2 Protein, N-His

Product name ARO-P10698-100
Uniprot ID Q99496
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Molecular weight 15.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu225-Lys336
Aliases /Synonyms Huntingtin-interacting protein 2-interacting protein 3, RING-type E3 ubiquitin transferase RING2, E3 ubiquitin-protein ligase RING2, HIP2-interacting protein 3, DING, RING finger protein 1B, BAP1, Protein DinG, RING1B, RING finger protein 2, HIPI3, RNF2, RING finger protein BAP-1, RING1b
Reference ARO-P10698
Note For research use only.
Molecular Constructor
Glu225–Lys336
Product name ARO-P10698-1MG
Uniprot ID Q99496
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Molecular weight 15.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu225-Lys336
Aliases /Synonyms Huntingtin-interacting protein 2-interacting protein 3, RING-type E3 ubiquitin transferase RING2, E3 ubiquitin-protein ligase RING2, HIP2-interacting protein 3, DING, RING finger protein 1B, BAP1, Protein DinG, RING1B, RING finger protein 2, HIPI3, RNF2, RING finger protein BAP-1, RING1b
Reference ARO-P10698
Note For research use only.
Molecular Constructor
Glu225–Lys336
Product name ARO-P10698-50
Uniprot ID Q99496
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Molecular weight 15.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu225-Lys336
Aliases /Synonyms Huntingtin-interacting protein 2-interacting protein 3, RING-type E3 ubiquitin transferase RING2, E3 ubiquitin-protein ligase RING2, HIP2-interacting protein 3, DING, RING finger protein 1B, BAP1, Protein DinG, RING1B, RING finger protein 2, HIPI3, RNF2, RING finger protein BAP-1, RING1b
Reference ARO-P10698
Note For research use only.
Molecular Constructor
Glu225–Lys336

Introduction

Recombinant Human RNF2 Protein is a highly purified and biologically active form of the RING finger protein 2 (RNF2), also known as Ring1b. This protein is produced through recombinant DNA technology, allowing for the expression and purification of a specific protein in large quantities. RNF2 is a key player in the regulation of gene expression and has been extensively studied for its role in various cellular processes.

Structure of Recombinant Human RNF2 Protein

Recombinant Human RNF2 Protein is a 38 kDa protein consisting of 351 amino acids. It contains a RING finger domain at its N-terminus, which is responsible for its E3 ubiquitin ligase activity. The C-terminus of RNF2 contains a chromatin-binding domain, which allows it to interact with other proteins and play a role in chromatin remodeling. The recombinant protein is produced in a mammalian expression system, ensuring proper folding and post-translational modifications.

Activity of Recombinant Human RNF2 Protein

RNF2 is a member of the Polycomb group (PcG) proteins, which are involved in the epigenetic regulation of gene expression. Specifically, RNF2 is part of the Polycomb repressive complex 1 (PRC1), which is responsible for maintaining gene silencing by promoting the ubiquitination of histone H2A. This leads to the compaction of chromatin and the repression of gene transcription. The E3 ubiquitin ligase activity of RNF2 is critical for this process, as it targets specific lysine residues on histone H2A for ubiquitination.

In addition to its role in gene silencing, RNF2 has also been implicated in other cellular processes such as DNA damage response, cell cycle regulation, and stem cell differentiation. It has been shown to interact with various proteins involved in these pathways, highlighting its multifunctional role in the cell.

Applications of Recombinant Human RNF2 Protein

The availability of highly purified and biologically active Recombinant Human RNF2 Protein has allowed for its use in various research applications. One of the main applications is in the study of gene regulation and epigenetics. The recombinant protein can be used to investigate the role of RNF2 in gene silencing and chromatin remodeling, as well as its interactions with other proteins in the PRC1 complex.

Another application of Recombinant Human RNF2 Protein is in drug discovery and development. As RNF2 has been linked to various diseases, including cancer and neurological disorders, it is a potential target for therapeutic intervention. The recombinant protein can be used in high-throughput screening assays to identify small molecules that can modulate its activity and potentially serve as lead compounds for drug development.

Furthermore, Recombinant Human RNF2 Protein can also be used in the development of diagnostic assays. As RNF2 has been shown to be dysregulated in certain diseases, its detection in patient samples could serve as a biomarker for disease diagnosis and monitoring.

Conclusion

In summary, Recombinant Human RNF2 Protein is a valuable tool for studying the structure, activity, and function of this important protein. Its use in various research applications has advanced our understanding of gene regulation and epigenetics, and has the potential to contribute to the development of novel therapeutics and diagnostic tools. As research in this field continues, the use of Recombinant Human RNF2 Protein will undoubtedly play a crucial role in furthering our knowledge and advancements in this area.

Recombinant Human RNF2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RNF2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products