Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RBX1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P62877
Molecular weight:
33.05 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Ala2–Arg46
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RBX1 Protein, N-GST & C-His

Product name ARO-P11358-100
Uniprot ID P62877
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICR
Molecular weight 33.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Arg46
Aliases /Synonyms RING finger protein 75, RNF75, E3 ubiquitin-protein transferase RBX1, N-terminally processed, RBX1, E3 ubiquitin-protein ligase RBX1, Rbx1, ROC1, E3 ubiquitin-protein transferase RBX1, Protein ZYP, RING-box protein 1, Regulator of cullins 1
Reference ARO-P11358
Note For research use only.
Molecular Constructor
Ala2–Arg46
Product name ARO-P11358-1MG
Uniprot ID P62877
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICR
Molecular weight 33.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Arg46
Aliases /Synonyms RING finger protein 75, RNF75, E3 ubiquitin-protein transferase RBX1, N-terminally processed, RBX1, E3 ubiquitin-protein ligase RBX1, Rbx1, ROC1, E3 ubiquitin-protein transferase RBX1, Protein ZYP, RING-box protein 1, Regulator of cullins 1
Reference ARO-P11358
Note For research use only.
Molecular Constructor
Ala2–Arg46
Product name ARO-P11358-50
Uniprot ID P62877
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICR
Molecular weight 33.05 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Arg46
Aliases /Synonyms RING finger protein 75, RNF75, E3 ubiquitin-protein transferase RBX1, N-terminally processed, RBX1, E3 ubiquitin-protein ligase RBX1, Rbx1, ROC1, E3 ubiquitin-protein transferase RBX1, Protein ZYP, RING-box protein 1, Regulator of cullins 1
Reference ARO-P11358
Note For research use only.
Molecular Constructor
Ala2–Arg46

Introduction

Recombinant Human RBX1 Protein, also known as RING box protein 1, is a highly conserved protein that plays a crucial role in the regulation of cellular processes such as protein degradation and DNA repair. It is a key component of the Skp1-Cullin-F-box (SCF) E3 ubiquitin ligase complex, which is responsible for targeting specific proteins for degradation through the ubiquitin-proteasome pathway. In this article, we will discuss the structure, activity and application of Recombinant Human RBX1 Protein.

Structure of Recombinant Human RBX1 Protein

Recombinant Human RBX1 Protein is a 113 amino acid protein with a molecular weight of approximately 12.5 kDa. It contains a RING finger domain, which is a conserved motif involved in protein-protein interactions and ubiquitin ligase activity. RBX1 also has a C-terminal domain that is responsible for binding to the Cul1 subunit of the SCF complex. The crystal structure of RBX1 has been determined and shows that it adopts a globular fold with a central β-sheet surrounded by α-helices.

Activity of Recombinant Human RBX1 Protein

Recombinant Human RBX1 Protein is an essential component of the SCF complex, which is responsible for targeting specific proteins for ubiquitination and subsequent degradation by the proteasome. RBX1 acts as a bridge between the Cul1 subunit and the F-box protein, which recognizes and binds to specific substrates. This interaction allows for the transfer of ubiquitin from the E2 enzyme to the substrate, marking it for degradation. RBX1 also has intrinsic E3 ubiquitin ligase activity, which enhances the efficiency of the SCF complex in targeting substrates for degradation.

In addition to its role in protein degradation, RBX1 also plays a crucial role in DNA repair. It has been shown to interact with and regulate the activity of the BRCA1-BARD1 complex, which is involved in DNA damage response and repair. RBX1 is also involved in the regulation of the cell cycle and cell proliferation through its interaction with the CUL1-CDK inhibitor complex.

Application of Recombinant Human RBX1 Protein

Recombinant Human RBX1 Protein has a wide range of applications in both basic research and drug development. Its role in protein degradation makes it a valuable tool for studying the regulation of cellular processes such as cell cycle, DNA repair and apoptosis. RBX1 has also been implicated in various diseases, including cancer, making it a potential target for drug development.

One of the major applications of RBX1 is in the production of recombinant proteins. The SCF complex, of which RBX1 is a key component, is widely used in the production of recombinant proteins for research and therapeutic purposes. RBX1 can also be used in the development of novel drug therapies targeting specific diseases, such as cancer, by regulating the activity of the SCF complex.

In addition, RBX1 has been used as a biomarker for cancer diagnosis and prognosis. Its overexpression has been observed in various types of cancer, including breast, lung and prostate cancer. This makes RBX1 a potential diagnostic and prognostic marker for these types of cancer.

Conclusion

In summary, Recombinant Human RBX1 Protein is a crucial component of the SCF complex that plays a vital role in protein degradation, DNA repair and cell cycle regulation. Its structure and activity make it a valuable tool for studying cellular processes and its potential as a drug target makes it an important protein in drug development. With its wide range of applications, RBX1 continues to be a focus of research in the fields of biochemistry, molecular biology and medicine.

Recombinant Human RBX1 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human RBX1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products