Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RBCK1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BYM8
Molecular weight:
19.94 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Met1–Gly156
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RBCK1 Protein, N-His

Product name ARO-P12038-100
Uniprot ID Q9BYM8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLG
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly156
Aliases /Synonyms RING finger protein 54, RNF54, RanBP-type and C3HC4-type zinc finger-containing protein 1, C20orf18, XAP4, Hepatitis B virus X-associated protein 4, UBCE7IP3, RBCK1, RING-type E3 ubiquitin transferase HOIL-1, HOIL-1, Heme-oxidized IRP2 ubiquitin ligase 1, XAP3, Ubiquitin-conjugating enzyme 7-interacting protein 3, HBV-associated factor 4
Reference ARO-P12038
Note For research use only.
Molecular Constructor
Met1–Gly156
Product name ARO-P12038-1MG
Uniprot ID Q9BYM8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLG
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly156
Aliases /Synonyms RING finger protein 54, RNF54, RanBP-type and C3HC4-type zinc finger-containing protein 1, C20orf18, XAP4, Hepatitis B virus X-associated protein 4, UBCE7IP3, RBCK1, RING-type E3 ubiquitin transferase HOIL-1, HOIL-1, Heme-oxidized IRP2 ubiquitin ligase 1, XAP3, Ubiquitin-conjugating enzyme 7-interacting protein 3, HBV-associated factor 4
Reference ARO-P12038
Note For research use only.
Molecular Constructor
Met1–Gly156
Product name ARO-P12038-50
Uniprot ID Q9BYM8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLG
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly156
Aliases /Synonyms RING finger protein 54, RNF54, RanBP-type and C3HC4-type zinc finger-containing protein 1, C20orf18, XAP4, Hepatitis B virus X-associated protein 4, UBCE7IP3, RBCK1, RING-type E3 ubiquitin transferase HOIL-1, HOIL-1, Heme-oxidized IRP2 ubiquitin ligase 1, XAP3, Ubiquitin-conjugating enzyme 7-interacting protein 3, HBV-associated factor 4
Reference ARO-P12038
Note For research use only.
Molecular Constructor
Met1–Gly156

The Structure of Recombinant Human RBCK1 Protein

Recombinant Human RBCK1 Protein is a type of protein that is produced through genetic engineering techniques in a laboratory setting. It is a recombinant protein, meaning that it is artificially created by combining genetic material from different sources. In this case, the genetic material used comes from human cells.

The structure of Recombinant Human RBCK1 Protein is made up of 528 amino acids, which are the building blocks of proteins. It has a molecular weight of approximately 60 kDa. The protein contains several functional domains, including a Ubiquitin-like domain, a Zinc finger domain, and a Ring finger domain. These domains play important roles in the activity of the protein.

The Activity of Recombinant Human RBCK1 Protein

Recombinant Human RBCK1 Protein is a key regulator of the Ubiquitin-Proteasome System (UPS), which is responsible for the degradation of proteins in the cell. The protein acts as an E3 ubiquitin ligase, which means it helps to transfer the small protein, ubiquitin, onto target proteins. This tagging with ubiquitin marks the target proteins for degradation by the proteasome.

RBCK1 has been shown to interact with various proteins involved in the UPS, such as the E2 ubiquitin-conjugating enzymes UbcH7 and UbcH8, as well as the proteasome subunit Rpn10. This interaction allows RBCK1 to play a crucial role in the regulation of protein turnover and quality control in the cell.

In addition to its role in the UPS, Recombinant Human RBCK1 Protein has also been found to be involved in other cellular processes. It has been shown to regulate the activity of the transcription factor NF-κB, which plays a critical role in immune response and inflammation. RBCK1 has also been implicated in the regulation of autophagy, a process by which cells break down and recycle damaged or unnecessary components.

The Application of Recombinant Human RBCK1 Protein

Recombinant Human RBCK1 Protein has a wide range of applications in both research and clinical settings. In research, it is commonly used as a tool to study the role of RBCK1 in various cellular processes. By manipulating the levels or activity of RBCK1, researchers can gain insights into its function and potential therapeutic applications.

In the clinical setting, Recombinant Human RBCK1 Protein has been studied as a potential therapeutic target for various diseases. Dysregulation of the UPS has been linked to several disorders, including cancer, neurodegenerative diseases, and autoimmune disorders. As RBCK1 plays a critical role in the UPS, it has been proposed as a potential target for drug development in these diseases.

Furthermore, studies have shown that RBCK1 levels are elevated in certain cancer types, making it a potential biomarker for cancer diagnosis and prognosis. Additionally, RBCK1 has been found to be involved in the regulation of immune response, making it a potential target for immunotherapy in autoimmune disorders.

In conclusion, Recombinant Human RBCK1 Protein is a crucial player in the regulation of protein turnover and quality control in the cell. Its structure, activity, and diverse range of applications make it a valuable tool for research and a potential target for therapeutic intervention in various diseases.

Recombinant Human RBCK1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RBCK1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products