Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GALE Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14376
Molecular weight:
40.44 kDa

Original price was: €396.00.Current price is: €319.00.

100ug 19% OFF + 319 loyalty points
Met1–Ala348
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GALE Protein, N-His

Product name ARO-P12181-100
Uniprot ID Q14376
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Molecular weight 40.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala348
Aliases /Synonyms UDP-galactose 4-epimerase, UDP-N-acetylgalactosamine 4-epimerase, Galactowaldenase, UDP-glucose 4-epimerase, GALE, UDP-GalNAc 4-epimerase, UDP-N-acetylglucosamine 4-epimerase, UDP-GlcNAc 4-epimerase
Reference ARO-P12181
Note For research use only.
Molecular Constructor
Met1–Ala348
Product name ARO-P12181-1MG
Uniprot ID Q14376
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Molecular weight 40.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala348
Aliases /Synonyms UDP-galactose 4-epimerase, UDP-N-acetylgalactosamine 4-epimerase, Galactowaldenase, UDP-glucose 4-epimerase, GALE, UDP-GalNAc 4-epimerase, UDP-N-acetylglucosamine 4-epimerase, UDP-GlcNAc 4-epimerase
Reference ARO-P12181
Note For research use only.
Molecular Constructor
Met1–Ala348
Product name ARO-P12181-50
Uniprot ID Q14376
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Molecular weight 40.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala348
Aliases /Synonyms UDP-galactose 4-epimerase, UDP-N-acetylgalactosamine 4-epimerase, Galactowaldenase, UDP-glucose 4-epimerase, GALE, UDP-GalNAc 4-epimerase, UDP-N-acetylglucosamine 4-epimerase, UDP-GlcNAc 4-epimerase
Reference ARO-P12181
Note For research use only.
Molecular Constructor
Met1–Ala348

Introduction

Recombinant proteins have become an essential tool in various fields of research, diagnostics, and therapeutics. One such protein is the Recombinant Human GALE Protein, which has gained significant attention due to its unique structure, activity, and potential applications. In this article, we will delve into the details of this protein and explore its various aspects.

Structure of Recombinant Human GALE Protein

The Recombinant Human GALE Protein is a recombinant form of the human UDP-galactose-4-epimerase (GALE) enzyme. It is encoded by the GALE gene located on chromosome 1 in humans. The protein is composed of 368 amino acids and has a molecular weight of approximately 41 kDa.

The crystal structure of Recombinant Human GALE Protein has been determined, and it consists of two domains – an N-terminal domain and a C-terminal domain. The N-terminal domain is responsible for binding to the substrate, while the C-terminal domain is involved in catalysis. The protein also contains a zinc ion, which is essential for its enzymatic activity.

Activity of Recombinant Human GALE Protein

Recombinant Human GALE Protein is a key enzyme involved in the biosynthesis of UDP-galactose, which is a critical precursor for the synthesis of glycolipids, glycoproteins, and proteoglycans. It catalyzes the conversion of UDP-glucose to UDP-galactose, which is a reversible reaction.

The enzymatic activity of Recombinant Human GALE Protein has been extensively studied, and it has been found to have a high specificity for its substrate. It also exhibits a high affinity for UDP-glucose, making it a highly efficient enzyme. The protein has been shown to have a pH optimum of 7.5-8.5 and a temperature optimum of 37°C.

Application of Recombinant Human GALE Protein

Recombinant Human GALE Protein has a wide range of potential applications due to its unique structure and activity. Some of its key applications are:

  • Production of glycosylated proteins: Recombinant Human GALE Protein can be used to produce glycosylated proteins in vitro. This can be useful in studying the role of glycosylation in various biological processes.
  • Detection of galactosemia: Galactosemia is a rare genetic disorder caused by a deficiency of GALE enzyme. Recombinant Human GALE Protein can be used as an antigen in diagnostic tests for galactosemia.
  • Development of therapeutics: Mutations in the GALE gene have been associated with various diseases, including galactosemia and cancer. Recombinant Human GALE Protein can be used to study the effects of these mutations and aid in the development of potential therapeutics.
  • Research on glycosylation disorders: Glycosylation disorders are a group of rare genetic disorders caused by defects in the glycosylation process. Recombinant Human GALE Protein can be used to study the role of GALE enzyme in these disorders and aid in the development of treatments.

Conclusion

Recombinant Human GALE Protein is a highly valuable protein with a unique structure and activity. Its potential applications in various fields make it an essential tool for research and diagnostics. With further studies and advancements, this protein has the potential to contribute significantly to the understanding and treatment of various diseases.

Recombinant Human GALE Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GALE Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products