Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PIDD1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HB75
Molecular weight:
23.81 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Phe694–Arg885
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PIDD1, N-His

Product name ARO-P13098-100
Uniprot ID Q9HB75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIR
Molecular weight 23.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe694-Arg885
Aliases /Synonyms Leucine-rich repeat and death domain-containing protein, PIDD1, p53-induced death domain-containing protein 1, PIDD, LRDD
Reference ARO-P13098
Note For research use only.
Molecular Constructor
Phe694–Arg885
Product name ARO-P13098-1MG
Uniprot ID Q9HB75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIR
Molecular weight 23.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe694-Arg885
Aliases /Synonyms Leucine-rich repeat and death domain-containing protein, PIDD1, p53-induced death domain-containing protein 1, PIDD, LRDD
Reference ARO-P13098
Note For research use only.
Molecular Constructor
Phe694–Arg885
Product name ARO-P13098-50
Uniprot ID Q9HB75
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIR
Molecular weight 23.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe694-Arg885
Aliases /Synonyms Leucine-rich repeat and death domain-containing protein, PIDD1, p53-induced death domain-containing protein 1, PIDD, LRDD
Reference ARO-P13098
Note For research use only.
Molecular Constructor
Phe694–Arg885

Introduction

Recombinant Human PIDD1, also known as p53-induced death domain protein 1, is a protein that plays a critical role in regulating cell death and survival pathways. It is a member of the death domain superfamily and is involved in the activation of caspase-2, a key enzyme in the apoptotic pathway. In this article, we will explore the structure, activity, and applications of Recombinant Human PIDD1.

Structure of Recombinant Human PIDD1

Recombinant Human PIDD1 is a 1057 amino acid protein with a molecular weight of approximately 120 kDa. It consists of several domains, including a death domain, a leucine zipper domain, a PIDDosome interaction domain, and a caspase recruitment domain. The death domain is responsible for protein-protein interactions and is essential for the activation of caspase-2. The leucine zipper domain is involved in the formation of protein complexes, while the PIDDosome interaction domain is responsible for the recruitment of other proteins to the PIDDosome complex. The caspase recruitment domain is crucial for the activation of caspase-2.

Activity of Recombinant Human PIDD1

Recombinant Human PIDD1 is a key regulator of cell death and survival pathways. It is activated in response to DNA damage or other cellular stresses and plays a critical role in the induction of apoptosis. Upon activation, PIDD1 forms a complex with its binding partners, RAIDD and PIDDosome, which then recruits and activates caspase-2. Activated caspase-2, in turn, triggers a cascade of events that ultimately leads to cell death. This process is important for maintaining cellular homeostasis and preventing the growth of damaged or abnormal cells.

Applications of Recombinant Human PIDD1

Recombinant Human PIDD1 has various applications in the field of research and medicine. One of its primary uses is in studying the mechanisms of cell death and survival. Its role in the activation of caspase-2 makes it an essential protein for understanding the apoptotic pathway and its dysregulation in diseases such as cancer. Recombinant Human PIDD1 is also used in drug discovery and development, as targeting this protein could lead to the development of novel therapies for cancer and other diseases.

Another potential application of Recombinant Human PIDD1 is in diagnostic testing. The PIDDosome complex, which includes PIDD1, has been found to be overexpressed in certain types of cancer, making it a potential biomarker for early detection and diagnosis. Recombinant Human PIDD1 can be used in diagnostic assays to detect the presence of PIDDosome in patient samples, allowing for the early detection and treatment of cancer.

Furthermore, Recombinant Human PIDD1 has been studied for its potential as a therapeutic target. Inhibitors of PIDD1 have been developed and tested in preclinical studies for their ability to block the activation of caspase-2 and promote cell survival. This could have significant implications for the treatment of diseases where cell death is dysregulated, such as neurodegenerative disorders.

Conclusion

In summary, Recombinant Human PIDD1 is a critical protein involved in regulating cell death and survival pathways. Its structure, activity, and applications have been extensively studied, and it has shown potential as a therapeutic target and diagnostic biomarker. Further research on this protein and its interactions could lead to the development of new treatments for diseases such as cancer and neurodegenerative disorders.

Recombinant Human PIDD1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PIDD1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products