Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PER2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O15055
Molecular weight:
37.04 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Ser172–Pro475
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PER2 Protein, N-His

Product name ARO-P12423-100
Uniprot ID O15055
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTVEEMESVTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRDQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVP
Molecular weight 37.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Pro475
Aliases /Synonyms Circadian clock protein PERIOD 2, KIAA0347, Period circadian protein homolog 2, PER2, hPER2
Reference ARO-P12423
Note For research use only.
Molecular Constructor
Ser172–Pro475
Product name ARO-P12423-1MG
Uniprot ID O15055
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTVEEMESVTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRDQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVP
Molecular weight 37.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Pro475
Aliases /Synonyms Circadian clock protein PERIOD 2, KIAA0347, Period circadian protein homolog 2, PER2, hPER2
Reference ARO-P12423
Note For research use only.
Molecular Constructor
Ser172–Pro475
Product name ARO-P12423-50
Uniprot ID O15055
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTVEEMESVTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRDQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVP
Molecular weight 37.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Pro475
Aliases /Synonyms Circadian clock protein PERIOD 2, KIAA0347, Period circadian protein homolog 2, PER2, hPER2
Reference ARO-P12423
Note For research use only.
Molecular Constructor
Ser172–Pro475

Introduction to Recombinant Human PER2 Protein

Recombinant Human PER2 Protein, also known as Period Circadian Protein 2, is a key regulator of the circadian rhythm in humans. It is a highly conserved protein that plays a crucial role in maintaining the body’s internal clock and regulating various biological processes, such as sleep-wake cycles, hormone secretion, and metabolism. In this article, we will dive into the structure, activity, and applications of this important protein.

Structure of Recombinant Human PER2 Protein

The human PER2 gene is located on chromosome 2 and encodes for a 1,461 amino acid protein. The protein is composed of several domains, including a PAS domain, two PER-ARNT-SIM (PAS) domains, and a C-terminal domain. These domains are responsible for the protein’s activity and interactions with other proteins.

The PAS domain is a conserved structural motif found in many proteins involved in circadian rhythm regulation. It acts as a sensor for environmental cues, such as light and temperature, and helps in the synchronization of the internal clock with the external environment. The two PAS domains in PER2 are known as PAS-A and PAS-B, and they play a crucial role in the protein’s interaction with other circadian clock proteins.

The C-terminal domain of PER2 is responsible for its nuclear localization and transcriptional activity. It contains a nuclear localization signal (NLS) that allows the protein to enter the nucleus and regulate gene expression. This domain also interacts with other clock proteins, such as CLOCK and BMAL1, to form a transcriptional complex that controls the expression of clock-controlled genes.

Activity of Recombinant Human PER2 Protein

The activity of Recombinant Human PER2 Protein is tightly regulated by post-translational modifications, such as phosphorylation and ubiquitination. These modifications play a crucial role in controlling the protein’s stability, localization, and interaction with other proteins.

One of the key functions of PER2 is to inhibit the activity of the CLOCK-BMAL1 transcriptional complex. This is achieved through the protein’s interaction with the complex and its ability to repress its transcriptional activity. This negative feedback loop is essential for maintaining the circadian rhythm and ensuring its synchronization with the external environment.

In addition to its role in regulating the circadian clock, PER2 also plays a role in other biological processes. It has been shown to regulate the expression of genes involved in metabolism, cell cycle, and immune response. This highlights the importance of PER2 in maintaining the overall health and well-being of an individual.

Applications of Recombinant Human PER2 Protein

The unique structure and activity of Recombinant Human PER2 Protein make it a valuable tool in various research applications. One of the most significant uses of this protein is in studying the circadian rhythm and its impact on human health. By manipulating the expression and activity of PER2, researchers can gain a better understanding of how the internal clock works and how it affects various physiological processes.

Additionally, Recombinant Human PER2 Protein has potential therapeutic applications. Mutations in the PER2 gene have been linked to sleep disorders, metabolic diseases, and psychiatric disorders. By studying the structure and function of this protein, researchers can develop targeted therapies to treat these conditions and improve the overall health of individuals.

In conclusion, Recombinant Human PER2 Protein is a critical component of the circadian clock and plays a vital role in regulating various biological processes. Its unique structure and activity make it a valuable tool for studying the internal clock and its impact on human health. With further research, this protein may also have therapeutic applications in treating various diseases and disorders.

Recombinant Human PER2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PER2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products