Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CTRL Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P40313
Molecular weight:
25.19 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Val49–Asn264
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CTRL Protein, N-His

Product name ARO-P11289-100
Uniprot ID P40313
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Molecular weight 25.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val49-Asn264
Aliases /Synonyms CTRL1, CTRL, Chymotrypsin-like protease CTRL-1
Reference ARO-P11289
Note For research use only.
Molecular Constructor
Val49–Asn264
Product name ARO-P11289-1MG
Uniprot ID P40313
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Molecular weight 25.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val49-Asn264
Aliases /Synonyms CTRL1, CTRL, Chymotrypsin-like protease CTRL-1
Reference ARO-P11289
Note For research use only.
Molecular Constructor
Val49–Asn264
Product name ARO-P11289-50
Uniprot ID P40313
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Molecular weight 25.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val49-Asn264
Aliases /Synonyms CTRL1, CTRL, Chymotrypsin-like protease CTRL-1
Reference ARO-P11289
Note For research use only.
Molecular Constructor
Val49–Asn264

Introduction to Recombinant Human CTRL Protein

Recombinant Human CTRL Protein, also known as Recombinant Human Carboxyl-terminal Regulatory Protein, is a protein that plays a crucial role in regulating cell growth and division. It is a recombinant protein, meaning it is produced through genetic engineering techniques, making it a valuable tool in various scientific and medical applications.

Structure of Recombinant Human CTRL Protein

Recombinant Human CTRL Protein is a 54 kDa protein composed of 478 amino acids. It belongs to the family of carboxyl-terminal regulatory proteins, which are known for their role in controlling cell proliferation and differentiation. The protein contains a conserved C-terminal domain that is essential for its function.

The recombinant form of CTRL Protein is produced in a laboratory using a genetically modified host cell, typically E. coli. The protein is then purified and undergoes quality control measures to ensure its purity and activity.

Activity of Recombinant Human CTRL Protein

The main function of Recombinant Human CTRL Protein is to regulate the activity of the mitogen-activated protein kinase (MAPK) pathway, which is involved in cell proliferation and differentiation. This pathway is essential for normal cellular processes, but dysregulation of the MAPK pathway has been linked to various diseases, including cancer.

Recombinant Human CTRL Protein acts as a negative regulator of the MAPK pathway by binding to and inhibiting the activity of the Raf kinase, a key component of the pathway. This prevents the excessive activation of the MAPK pathway, maintaining its balance and ensuring proper cell growth and division.

In addition to its role in regulating the MAPK pathway, Recombinant Human CTRL Protein has also been shown to have anti-inflammatory properties. It can inhibit the production of pro-inflammatory cytokines, making it a potential therapeutic target for inflammatory diseases.

Applications of Recombinant Human CTRL Protein

The unique structure and activity of Recombinant Human CTRL Protein make it a valuable tool in various scientific and medical applications. Here are some of its most significant applications:

1. Research Tool

Recombinant Human CTRL Protein is widely used as a research tool to study the MAPK pathway and its role in different cellular processes. Its ability to inhibit the activity of the Raf kinase makes it a valuable tool for understanding the molecular mechanisms behind various diseases, particularly cancer.

2. Drug Development

Due to its anti-inflammatory properties, Recombinant Human CTRL Protein has shown potential as a therapeutic target for inflammatory diseases. Its ability to inhibit the production of pro-inflammatory cytokines makes it a promising candidate for the development of novel anti-inflammatory drugs.

3. Diagnostic Marker

Abnormalities in the MAPK pathway have been linked to various diseases, including cancer and autoimmune disorders. Recombinant Human CTRL Protein can serve as a diagnostic marker for these conditions, as its levels can indicate the activity of the MAPK pathway and potential disease progression.

4. Vaccine Development

Recombinant Human CTRL Protein can also be used in vaccine development. Its ability to regulate the MAPK pathway makes it a potential antigen for vaccines targeting diseases that involve dysregulation of this pathway, such as cancer and autoimmune disorders.

Conclusion

In summary, Recombinant Human CTRL Protein is a crucial protein in regulating cell growth and division. Its unique structure and activity make it a valuable tool in various scientific and medical applications, including research, drug development, diagnostics, and vaccine development. Further studies on this protein can lead to a better understanding of its role in different diseases and potential therapeutic applications.

Recombinant Human CTRL Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CTRL Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products