Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GORAB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5T7V8
Molecular weight:
16.30 kDa

Original price was: €308.00.Current price is: €275.00.

100ug 11% OFF + 275 loyalty points
Met156–Asp275
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GORAB Protein, N-His

Product name ARO-P11290-100
Uniprot ID Q5T7V8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLD
Molecular weight 16.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met156-Asp275
Aliases /Synonyms NTKLBP1, NTKL-BP1, SCYL1-binding protein 1, SCYL1BP1, SCY1-like 1-binding protein 1, GORAB, NTKL-binding protein 1, SCYL1-BP1, hNTKL-BP1, RAB6-interacting golgin, N-terminal kinase-like-binding protein 1
Reference ARO-P11290
Note For research use only.
Molecular Constructor
Met156–Asp275
Product name ARO-P11290-1MG
Uniprot ID Q5T7V8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLD
Molecular weight 16.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met156-Asp275
Aliases /Synonyms NTKLBP1, NTKL-BP1, SCYL1-binding protein 1, SCYL1BP1, SCY1-like 1-binding protein 1, GORAB, NTKL-binding protein 1, SCYL1-BP1, hNTKL-BP1, RAB6-interacting golgin, N-terminal kinase-like-binding protein 1
Reference ARO-P11290
Note For research use only.
Molecular Constructor
Met156–Asp275
Product name ARO-P11290-50
Uniprot ID Q5T7V8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLD
Molecular weight 16.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met156-Asp275
Aliases /Synonyms NTKLBP1, NTKL-BP1, SCYL1-binding protein 1, SCYL1BP1, SCY1-like 1-binding protein 1, GORAB, NTKL-binding protein 1, SCYL1-BP1, hNTKL-BP1, RAB6-interacting golgin, N-terminal kinase-like-binding protein 1
Reference ARO-P11290
Note For research use only.
Molecular Constructor
Met156–Asp275

Introduction

Recombinant Human GORAB Protein, also known as Golgin-45, is a protein that plays a crucial role in the development and maintenance of the Golgi apparatus. The Golgi apparatus is a vital organelle in eukaryotic cells responsible for modifying, sorting, and packaging proteins for transport to other parts of the cell or outside the cell. Recombinant Human GORAB Protein is a recombinant form of the naturally occurring GORAB protein and has been extensively studied for its structure, activity, and potential applications.

Structure of Recombinant Human GORAB Protein

Recombinant Human GORAB Protein is a 49-kDa protein consisting of 438 amino acids. It belongs to the golgin family of proteins and is highly conserved across different species, indicating its important role in cellular function. The protein contains a coiled-coil domain, which is essential for protein-protein interactions, and a C-terminal transmembrane domain that anchors it to the Golgi membrane. The N-terminal region of the protein is responsible for its Golgi localization and is crucial for its function.

Activity of Recombinant Human GORAB Protein

Recombinant Human GORAB Protein is involved in maintaining the structure and function of the Golgi apparatus. It interacts with other Golgi proteins, such as GM130 and Golgin-84, to form a complex that regulates the formation and maintenance of the Golgi ribbon. This complex is essential for the proper trafficking of proteins and lipids within the Golgi and for the maintenance of Golgi morphology. Recombinant Human GORAB Protein also plays a role in the regulation of cell migration and cell adhesion by modulating the activity of Rho GTPases, which are important for controlling the cytoskeleton.

Applications of Recombinant Human GORAB Protein

Recombinant Human GORAB Protein has been widely studied for its potential applications in various fields. One of the primary applications of this protein is in the study of Golgi-related diseases. Mutations in the GORAB gene have been linked to a rare genetic disorder called geroderma osteodysplastica (GO), which is characterized by premature aging, skin abnormalities, and skeletal deformities. Recombinant Human GORAB Protein has been used in research to better understand the role of this protein in the development of GO and to potentially develop therapeutic strategies.

Another potential application of Recombinant Human GORAB Protein is in the development of vaccines. The protein has been identified as an antigen in several pathogens, including Mycobacterium tuberculosis and Streptococcus pyogenes. Recombinant Human GORAB Protein has been used to produce antibodies that can target and neutralize these pathogens, making it a potential candidate for vaccine development.

Moreover, Recombinant Human GORAB Protein has also been studied for its role in cancer. Studies have shown that this protein is involved in the regulation of cell migration and invasion, which are crucial processes in cancer metastasis. Recombinant Human GORAB Protein has been used in research to understand its role in cancer progression and to potentially develop targeted therapies.

Conclusion

In conclusion, Recombinant Human GORAB Protein is a crucial protein in the development and maintenance of the Golgi apparatus. Its structure and activity have been extensively studied, and it has shown potential applications in various fields, including the study of Golgi-related diseases, vaccine development, and cancer research. Further studies on this protein may lead to a better understanding of its role in cellular function and the development of new therapeutic strategies.

Recombinant Human GORAB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GORAB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products