Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NHEJ1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H9Q4
Molecular weight:
16.53 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Met1–Ser127
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NHEJ1 Protein, N-His

Product name ARO-P12118-100
Uniprot ID Q9H9Q4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLAS
Molecular weight 16.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser127
Aliases /Synonyms Non-homologous end-joining factor 1, XRCC4-like factor, NHEJ1, XLF, Protein cernunnos
Reference ARO-P12118
Note For research use only.
Molecular Constructor
Met1–Ser127
Product name ARO-P12118-1MG
Uniprot ID Q9H9Q4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLAS
Molecular weight 16.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser127
Aliases /Synonyms Non-homologous end-joining factor 1, XRCC4-like factor, NHEJ1, XLF, Protein cernunnos
Reference ARO-P12118
Note For research use only.
Molecular Constructor
Met1–Ser127
Product name ARO-P12118-50
Uniprot ID Q9H9Q4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLAS
Molecular weight 16.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser127
Aliases /Synonyms Non-homologous end-joining factor 1, XRCC4-like factor, NHEJ1, XLF, Protein cernunnos
Reference ARO-P12118
Note For research use only.
Molecular Constructor
Met1–Ser127

Introduction

Recombinant proteins have become essential tools in the fields of biotechnology and medicine. They are produced by genetically engineering organisms to express specific proteins that have therapeutic, diagnostic, or research applications. One such protein is the Recombinant Human NHEJ1 Protein, which plays a crucial role in DNA repair and has potential applications in cancer treatment and gene therapy. In this article, we will delve into the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human NHEJ1 Protein

The Recombinant Human NHEJ1 Protein is a 39 kDa protein that consists of 354 amino acids. It is encoded by the NHEJ1 gene, also known as Cernunnos, and is highly conserved among different species. The protein is composed of two domains, the N-terminal domain and the C-terminal domain, connected by a flexible linker region.

The N-terminal domain contains a BRCT (BRCA1 C-terminus) motif, which is involved in protein-protein interactions and is essential for the recruitment of NHEJ1 to DNA damage sites. The C-terminal domain contains a SAP (SAF-A/B, Acinus, and PIAS) motif, which is responsible for binding to DNA and is crucial for the protein’s activity in DNA repair.

Activity of Recombinant Human NHEJ1 Protein

The main function of Recombinant Human NHEJ1 Protein is to repair DNA double-strand breaks (DSBs), which are the most dangerous type of DNA damage. DSBs can be caused by various factors, including radiation, chemicals, and errors during DNA replication. If left unrepaired, DSBs can lead to cell death or genomic instability, which can contribute to the development of diseases such as cancer.

NHEJ1 is a key component of the non-homologous end joining (NHEJ) pathway, which is the primary mechanism for repairing DSBs in mammalian cells. NHEJ1 works by binding to the broken DNA ends and recruiting other proteins to form a complex that repairs the damage. It also plays a crucial role in regulating the activity of other NHEJ proteins, ensuring efficient and accurate repair of DSBs.

Applications of Recombinant Human NHEJ1 Protein

The role of NHEJ1 in DNA repair makes it a promising target for cancer treatment and gene therapy. Cancer cells often have defects in the NHEJ pathway, making them more reliant on other DNA repair mechanisms. By inhibiting NHEJ1, it is possible to selectively kill cancer cells while sparing healthy cells that have intact NHEJ function.

Moreover, NHEJ1 has been shown to enhance the efficiency of gene therapy, which involves introducing new genetic material into cells to treat genetic disorders. By co-delivering NHEJ1 with the therapeutic gene, it is possible to increase the integration of the gene into the cell’s genome, leading to more effective treatment.

Conclusion

The Recombinant Human NHEJ1 Protein is a vital component of the NHEJ pathway, responsible for repairing DNA double-strand breaks. Its structure, activity, and applications make it a valuable tool in cancer treatment and gene therapy. Further research on this protein could lead to the development of novel therapies for various diseases.

Keywords: Recombinant protein, antigen, NHEJ1, DNA repair, cancer treatment, gene therapy, NHEJ pathway.

Recombinant Human NHEJ1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NHEJ1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products