Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NEIL3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TAT5
Molecular weight:
33.75 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Met1–Lys281
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NEIL3 Protein, N-His

Product name ARO-P10721-100
Uniprot ID Q8TAT5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQK
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys281
Aliases /Synonyms DNA glycosylase FPG2, NEIL3, Endonuclease 8-like 3, Endonuclease VIII-like 3, Nei-like protein 3, DNA glycosylase/AP lyase Neil3
Reference ARO-P10721
Note For research use only.
Molecular Constructor
Met1–Lys281
Product name ARO-P10721-1MG
Uniprot ID Q8TAT5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQK
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys281
Aliases /Synonyms DNA glycosylase FPG2, NEIL3, Endonuclease 8-like 3, Endonuclease VIII-like 3, Nei-like protein 3, DNA glycosylase/AP lyase Neil3
Reference ARO-P10721
Note For research use only.
Molecular Constructor
Met1–Lys281
Product name ARO-P10721-50
Uniprot ID Q8TAT5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDSSQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLEVQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDVLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQK
Molecular weight 33.75 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys281
Aliases /Synonyms DNA glycosylase FPG2, NEIL3, Endonuclease 8-like 3, Endonuclease VIII-like 3, Nei-like protein 3, DNA glycosylase/AP lyase Neil3
Reference ARO-P10721
Note For research use only.
Molecular Constructor
Met1–Lys281

Introduction

Recombinant Human NEIL3 Protein is a type of recombinant protein that has been extensively studied for its structure, activity, and potential applications in various fields of research. This protein belongs to the NEIL family of DNA glycosylases, which are enzymes involved in DNA repair mechanisms. In this article, we will explore the structure, activity, and potential applications of Recombinant Human NEIL3 Protein.

Structure of Recombinant Human NEIL3 Protein

Recombinant Human NEIL3 Protein is a 429 amino acid long protein with a molecular weight of approximately 48 kDa. It contains a highly conserved catalytic domain, which is responsible for its DNA glycosylase activity. This domain is composed of a helix-two-turn-helix motif and a zinc-binding motif, which are essential for the catalytic activity of the protein.

The protein also contains a C-terminal domain, which is involved in protein-protein interactions and is essential for its function in DNA repair. The C-terminal domain is also responsible for the nuclear localization of the protein, as Recombinant Human NEIL3 Protein is predominantly found in the nucleus of cells.

Activity of Recombinant Human NEIL3 Protein

Recombinant Human NEIL3 Protein is a DNA glycosylase, which means it has the ability to recognize and remove damaged bases from DNA. Specifically, it is involved in the repair of oxidative DNA damage, which is caused by reactive oxygen species (ROS). This type of damage can lead to mutations and ultimately, diseases such as cancer.

The activity of Recombinant Human NEIL3 Protein is dependent on its catalytic domain, which is responsible for binding to damaged DNA and cleaving the glycosidic bond between the damaged base and the sugar backbone of DNA. This results in the removal of the damaged base, which is then replaced with a correct base by other DNA repair enzymes.

Applications of Recombinant Human NEIL3 Protein

Recombinant Human NEIL3 Protein has potential applications in various fields of research, including cancer biology, aging, and neurodegenerative diseases. Its role in repairing oxidative DNA damage makes it a potential target for cancer therapy. In fact, studies have shown that NEIL3 expression is dysregulated in various types of cancer, and targeting this protein could potentially lead to the development of new cancer treatments.

In addition, Recombinant Human NEIL3 Protein has also been linked to aging and age-related diseases. As we age, our cells accumulate DNA damage, which can lead to cellular dysfunction and ultimately, age-related diseases. By understanding the role of NEIL3 in DNA repair, researchers hope to develop interventions that can delay or prevent age-related diseases.

Furthermore, Recombinant Human NEIL3 Protein has also been implicated in neurodegenerative diseases such as Alzheimer’s and Parkinson’s. These diseases are characterized by the accumulation of damaged DNA in neurons, leading to cellular dysfunction and ultimately, neuronal death. By studying the role of NEIL3 in DNA repair, researchers hope to develop treatments that can slow down or reverse the progression of these diseases.

Conclusion

In summary, Recombinant Human NEIL3 Protein is a DNA glycosylase that plays a crucial role in repairing oxidative DNA damage. Its structure, activity, and potential applications make it a highly studied protein in the field of DNA repair and various other areas of research. Further studies on this protein could potentially lead to the development of new treatments for cancer, aging, and neurodegenerative diseases.

Recombinant Human NEIL3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NEIL3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products