Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LSS, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P48449
Molecular weight:
20.69 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
His Asp388–Pro549
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LSS, N-His

Product name ARO-P13708-100
Uniprot ID P48449
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFP
Molecular weight 20.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp388-Pro549
Aliases /Synonyms OSC, Lanosterol synthase, hOSC, Oxidosqualene--lanosterol cyclase, 2,3-epoxysqualene--lanosterol cyclase, LSS
Reference ARO-P13708
Note For research use only.
Molecular Constructor
His Asp388–Pro549
Product name ARO-P13708-1MG
Uniprot ID P48449
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFP
Molecular weight 20.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp388-Pro549
Aliases /Synonyms OSC, Lanosterol synthase, hOSC, Oxidosqualene--lanosterol cyclase, 2,3-epoxysqualene--lanosterol cyclase, LSS
Reference ARO-P13708
Note For research use only.
Molecular Constructor
His Asp388–Pro549
Product name ARO-P13708-50
Uniprot ID P48449
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFP
Molecular weight 20.69 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp388-Pro549
Aliases /Synonyms OSC, Lanosterol synthase, hOSC, Oxidosqualene--lanosterol cyclase, 2,3-epoxysqualene--lanosterol cyclase, LSS
Reference ARO-P13708
Note For research use only.
Molecular Constructor
His Asp388–Pro549

Introduction

Recombinant Human LSS, also known as Lanosterol Synthase, is a key enzyme involved in the biosynthesis of cholesterol. This enzyme is encoded by the LSS gene and is responsible for the conversion of squalene to lanosterol, a critical step in the cholesterol synthesis pathway. In recent years, recombinant Human LSS has gained significant attention in the field of biotechnology and pharmaceutical research due to its potential applications in drug discovery and development. In this article, we will provide a comprehensive overview of the structure, activity, and applications of recombinant Human LSS.

Structure of Recombinant Human LSS

Recombinant Human LSS is a homodimeric protein consisting of two identical subunits, each with a molecular weight of approximately 60 kDa. The crystal structure of recombinant Human LSS has been determined, revealing a three-dimensional arrangement of alpha-helices and beta-sheets. The active site of the enzyme is located in a deep pocket at the interface of the two subunits and is composed of conserved amino acid residues essential for catalytic activity.

Activity of Recombinant Human LSS

The primary function of recombinant Human LSS is to catalyze the cyclization of squalene, a linear hydrocarbon, to form lanosterol, a tetracyclic sterol. This reaction involves a series of complex steps, including the formation of carbocations and the rearrangement of chemical bonds. Recombinant Human LSS is highly specific for squalene and has a high turnover rate, making it an efficient catalyst in the cholesterol biosynthesis pathway.

Applications of Recombinant Human LSS

Recombinant Human LSS has a wide range of potential applications in the fields of biotechnology and pharmaceutical research. Some of the key applications of this enzyme are:

1. Drug Discovery

The cholesterol biosynthesis pathway is a well-known target for the development of drugs to treat hypercholesterolemia and other related disorders. Recombinant Human LSS can be used to screen for potential inhibitors or activators of the enzyme, which can then be further developed into therapeutic agents.

2. Production of Recombinant Proteins

Recombinant Human LSS has been successfully used as a fusion partner for the production of recombinant proteins in various expression systems. This enzyme can increase the solubility and stability of the target protein, leading to higher yields and improved purification.

3. Vaccine Development

Recombinant Human LSS has been identified as a potential antigen for the development of vaccines against fungal infections. This enzyme is highly conserved among different fungal species and can elicit a strong immune response, making it a promising candidate for vaccine development.

4. Biocatalysis

Recombinant Human LSS has also been explored for its potential in biocatalysis, particularly in the production of sterols and other related compounds. This enzyme offers several advantages over chemical catalysts, including higher selectivity and lower environmental impact.

5. Research Tool

Recombinant Human LSS is a valuable research tool for studying the structure and function of the cholesterol biosynthesis pathway. Its high specificity and activity make it an ideal enzyme for biochemical and biophysical studies.

Conclusion

In summary, recombinant Human LSS is a key enzyme involved in the biosynthesis of cholesterol with potential applications in drug discovery, protein production, vaccine development, biocatalysis, and research. Its well-defined structure and high catalytic activity make it a valuable tool in various fields of science. Further research and development of this enzyme may lead to new and innovative treatments for various diseases and disorders.

Recombinant Human LSS, N-His

There are no reviews yet.

Be the first to review “Recombinant Human LSS, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products