Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

  • ARO-A15482-50
  • Validated FC

Original price was: €334.00.Current price is: €274.00.

50ug 18% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

Product name ARO-A15482-100
Uniprot ID Q96E93
Raw Antigen Sequence MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15482
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen KLRG1/CLEC15A
Clone Name SAA0508
Protein Name KLRG1/CLEC15A
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15482-1MG
Uniprot ID Q96E93
Raw Antigen Sequence MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15482
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen KLRG1/CLEC15A
Clone Name SAA0508
Protein Name KLRG1/CLEC15A
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15482-50
Uniprot ID Q96E93
Raw Antigen Sequence MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15482
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen KLRG1/CLEC15A
Clone Name SAA0508
Protein Name KLRG1/CLEC15A
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

Flow Cytometry results for Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

Target Cells were stained with an irrelevant antibody or Anti-Human KLRG1/CLEC15A Antibody (SAA0508) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

SDS-PAGE for Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

Anti-Human KLRG1/CLEC15A Antibody (SAA0508), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human KLRG1/CLEC15A Antibody (SAA0508)

There are no reviews yet.

Be the first to review “Anti-Human KLRG1/CLEC15A Antibody (SAA0508)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products