Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL16 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14005
Molecular weight:
24.94 kDa

Original price was: €362.00.Current price is: €329.00.

100ug 9% OFF + 329 loyalty points
Ser1080–Arg1196
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL16 Protein, N-His-SUMO

Product name ARO-P11140-100
Uniprot ID Q14005
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTR
Molecular weight 24.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1080-Arg1196
Aliases /Synonyms LCF, IL-16, Lymphocyte chemoattractant factor, IL16, Pro-interleukin-16
Reference ARO-P11140
Note For research use only.
Molecular Constructor
Ser1080–Arg1196
Product name ARO-P11140-1MG
Uniprot ID Q14005
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTR
Molecular weight 24.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1080-Arg1196
Aliases /Synonyms LCF, IL-16, Lymphocyte chemoattractant factor, IL16, Pro-interleukin-16
Reference ARO-P11140
Note For research use only.
Molecular Constructor
Ser1080–Arg1196
Product name ARO-P11140-50
Uniprot ID Q14005
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTR
Molecular weight 24.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1080-Arg1196
Aliases /Synonyms LCF, IL-16, Lymphocyte chemoattractant factor, IL16, Pro-interleukin-16
Reference ARO-P11140
Note For research use only.
Molecular Constructor
Ser1080–Arg1196

Introduction to Recombinant Human IL16 Protein

Recombinant Human IL16 Protein, also known as interleukin-16, is a cytokine that plays a crucial role in the immune system. It is a small protein with a molecular weight of approximately 14 kDa and is encoded by the IL16 gene located on chromosome 15 in humans. IL16 was first identified as a chemoattractant for CD4+ T cells and has since been found to have multiple functions in both the innate and adaptive immune responses. In this article, we will explore the structure, activity, and applications of Recombinant Human IL16 Protein.

Structure of Recombinant Human IL16 Protein

Recombinant Human IL16 Protein is produced by recombinant DNA technology, where the gene encoding IL16 is cloned into a suitable expression vector and then expressed in a host cell. The resulting protein is a homodimer consisting of two identical subunits, each containing 130 amino acids. The primary structure of IL16 is highly conserved among different species, with human and mouse IL16 sharing 75% sequence identity.

The secondary structure of IL16 is predominantly alpha-helical, with a long central region rich in proline residues. This region is responsible for the chemoattractant activity of IL16, as it binds to the CD4 receptor on T cells and induces their migration. The tertiary structure of IL16 is stabilized by disulfide bonds between cysteine residues, and the protein has a globular shape with a hydrophobic core.

Activity of Recombinant Human IL16 Protein

Recombinant Human IL16 Protein has a variety of activities in the immune system, making it a crucial player in both innate and adaptive immunity. Its most well-known function is its chemoattractant activity, where it binds to the CD4 receptor on T cells and induces their migration towards sites of inflammation or infection. This is important in recruiting immune cells to the site of infection and initiating an immune response.

IL16 also has immunomodulatory effects, as it can activate and enhance the function of different immune cells, including T cells, natural killer cells, and monocytes. It can also inhibit the proliferation of certain immune cells, such as eosinophils and mast cells, which are involved in allergic reactions. Additionally, IL16 has been shown to have anti-inflammatory properties, as it can suppress the production of pro-inflammatory cytokines.

Applications of Recombinant Human IL16 Protein

Recombinant Human IL16 Protein has a wide range of applications in both basic research and clinical settings. In research, it is commonly used as a chemoattractant to study the migration of immune cells, particularly CD4+ T cells. It is also used in in vitro assays to assess the immunomodulatory effects of different compounds on immune cells.

In clinical settings, Recombinant Human IL16 Protein has shown potential as a therapeutic agent for various diseases. Its chemoattractant activity can be utilized to recruit immune cells to sites of cancer, making it a potential adjuvant therapy for cancer treatment. IL16 has also been studied for its potential in treating autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis, due to its immunomodulatory effects.

Conclusion

In summary, Recombinant Human IL16 Protein is a crucial cytokine in the immune system with multiple functions. Its structure, consisting of two subunits stabilized by disulfide bonds, allows it to perform its chemoattractant and immunomodulatory activities. In research, it is commonly used as a tool to study immune cell migration and function, while in clinical settings, it has potential as a therapeutic agent for various diseases. Further research on IL16 and its mechanisms of action may lead to the development of new treatments for immune-related disorders.

Recombinant Human IL16 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human IL16 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products