Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HMG20B Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9P0W2
Molecular weight:
23.83 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Tyr77–Gly171
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HMG20B Protein, N-His-SUMO

Product name ARO-P11327-100
Uniprot ID Q9P0W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNG
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr77-Gly171
Aliases /Synonyms HMGX2, BRAF35, HMG domain-containing protein HMGX2, HMG domain-containing protein 2, HMGXB2, Sox-like transcriptional factor, SMARCE1-related protein, HMG box-containing protein 20B, BRCA2-associated factor 35, HMG20B, Structural DNA-binding protein BRAF35, SMARCE1R, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
Reference ARO-P11327
Note For research use only.
Molecular Constructor
Tyr77–Gly171
Product name ARO-P11327-1MG
Uniprot ID Q9P0W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNG
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr77-Gly171
Aliases /Synonyms HMGX2, BRAF35, HMG domain-containing protein HMGX2, HMG domain-containing protein 2, HMGXB2, Sox-like transcriptional factor, SMARCE1-related protein, HMG box-containing protein 20B, BRCA2-associated factor 35, HMG20B, Structural DNA-binding protein BRAF35, SMARCE1R, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
Reference ARO-P11327
Note For research use only.
Molecular Constructor
Tyr77–Gly171
Product name ARO-P11327-50
Uniprot ID Q9P0W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNG
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr77-Gly171
Aliases /Synonyms HMGX2, BRAF35, HMG domain-containing protein HMGX2, HMG domain-containing protein 2, HMGXB2, Sox-like transcriptional factor, SMARCE1-related protein, HMG box-containing protein 20B, BRCA2-associated factor 35, HMG20B, Structural DNA-binding protein BRAF35, SMARCE1R, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
Reference ARO-P11327
Note For research use only.
Molecular Constructor
Tyr77–Gly171

Introduction

Recombinant Human HMG20B Protein is a type of protein that is produced through genetic engineering techniques, specifically recombinant DNA technology. It is a member of the high mobility group (HMG) protein family and is involved in various cellular processes such as transcriptional regulation, DNA repair, and chromatin remodeling. In this article, we will discuss the structure, activity, and application of Recombinant Human HMG20B Protein.

Structure of Recombinant Human HMG20B Protein

Recombinant Human HMG20B Protein is composed of 166 amino acids and has a molecular weight of approximately 19 kDa. It contains two HMG boxes, which are DNA-binding domains that allow the protein to interact with DNA. These HMG boxes are connected by a flexible linker region, which allows for the protein to bend and wrap around the DNA. The structure of Recombinant Human HMG20B Protein is similar to other members of the HMG family, but its specific sequence and arrangement of amino acids give it unique functions.

Activity of Recombinant Human HMG20B Protein

Recombinant Human HMG20B Protein is primarily involved in the regulation of gene expression. It functions as a transcriptional co-regulator, meaning it can either activate or repress the expression of specific genes. This activity is mediated by the protein’s ability to bind to DNA and interact with other transcription factors and co-regulators.

Additionally, Recombinant Human HMG20B Protein has been shown to play a role in DNA repair and chromatin remodeling. It can bind to damaged DNA and facilitate the recruitment of repair proteins, aiding in the repair process. It can also interact with chromatin-modifying enzymes, leading to changes in the structure of chromatin and regulation of gene expression.

Application of Recombinant Human HMG20B Protein

Due to its involvement in various cellular processes, Recombinant Human HMG20B Protein has a wide range of applications in both research and medicine. One of its main uses is in gene expression studies, where it can be used to study the role of specific genes and their regulatory mechanisms. It can also be used as a tool in drug discovery, as its activity can be targeted to modulate gene expression and potentially treat diseases.

In addition, Recombinant Human HMG20B Protein has been implicated in various diseases and disorders. For example, it has been found to be overexpressed in certain types of cancer, suggesting its potential as a diagnostic or therapeutic target. It has also been linked to neurodegenerative diseases such as Alzheimer’s and Parkinson’s, highlighting its importance in understanding these conditions.

Conclusion

In summary, Recombinant Human HMG20B Protein is a versatile protein with important roles in gene expression, DNA repair, and chromatin remodeling. Its structure, activity, and various applications make it a valuable tool in scientific research and a potential target for disease treatment. As our understanding of this protein continues to evolve, it is likely that its significance in both basic and clinical research will only increase.

Recombinant Human HMG20B Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human HMG20B Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products