Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL20 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NYY1
Molecular weight:
19.88 kDa

€329.00

100ug + 329 loyalty points
His Gly24–Glu176
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human IL20 recombinant protein

Product name Human IL20 recombinant protein
Uniprot ID Q9NYY1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Molecular weight 19.88 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly24-Glu176
Aliases /Synonyms Il-20, Interleukin-20, Interleukin 20, cytokine zcyto10
Reference PX-P6066
Note For research use only
Molecular Constructor
His Gly24–Glu176

Human IL20 recombinant protein

There are no reviews yet.

Be the first to review “Human IL20 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products