Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human DNMT3A recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6K1
Molecular weight:
34.98 kDa

329.00

100ug + 329 loyalty points
His Ala628–Val912
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human DNMT3A recombinant protein

Product name Human DNMT3A recombinant protein
Uniprot ID Q9Y6K1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
Molecular weight 34.98 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala628-Val912
Aliases /Synonyms Dnmt3a, DNA MTase HsaIIIA, DNMT3A, M.HsaIIIA, DNA (cytosine-5)-methyltransferase 3A, DNA methyltransferase HsaIIIA
Reference PX-P6065
Note For research use only
Molecular Constructor
His Ala628–Val912

SDS-PAGE for Human DNMT3A recombinant protein

SDS-PAGE for Human DNMT3A recombinant protein

Human DNMT3A recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human DNMT3A recombinant protein

There are no reviews yet.

Be the first to review “Human DNMT3A recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products