Brand: ProteoGenix

Human DNMT3A recombinant protein

PX-P6065
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: Q9Y6K1
Molecular weight:: 34.98 kDa

€329.00

100ug + 329 loyalty points

His Ala628–Val912

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Human DNMT3A recombinant protein

Datasheet

Human DNMT3A recombinant protein

Product name	Human DNMT3A recombinant protein
Uniprot ID	Q9Y6K1
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	AEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
Molecular weight	34.98 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>85% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ala628-Val912
Aliases /Synonyms	Dnmt3a, DNA MTase HsaIIIA, DNMT3A, M.HsaIIIA, DNA (cytosine-5)-methyltransferase 3A, DNA methyltransferase HsaIIIA
Reference	PX-P6065
Note	For research use only
Molecular Constructor	His Ala628–Val912