Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPR37 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O15354
Molecular weight:
32.97 kDa

Original price was: €245.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Arg401–Leu443
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPR37 Protein, N-GST & C-His

Product name ARO-P11357-100
Uniprot ID O15354
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARL
Molecular weight 32.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg401-Leu443
Aliases /Synonyms Endothelin B receptor-like protein 1, G-protein coupled receptor 37, Prosaposin receptor GPR37, Parkin-associated endothelin receptor-like receptor, GPR37, PAELR, ETBR-LP-1
Reference ARO-P11357
Note For research use only.
Molecular Constructor
Arg401–Leu443
Product name ARO-P11357-1MG
Uniprot ID O15354
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARL
Molecular weight 32.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg401-Leu443
Aliases /Synonyms Endothelin B receptor-like protein 1, G-protein coupled receptor 37, Prosaposin receptor GPR37, Parkin-associated endothelin receptor-like receptor, GPR37, PAELR, ETBR-LP-1
Reference ARO-P11357
Note For research use only.
Molecular Constructor
Arg401–Leu443
Product name ARO-P11357-50
Uniprot ID O15354
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARL
Molecular weight 32.97 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg401-Leu443
Aliases /Synonyms Endothelin B receptor-like protein 1, G-protein coupled receptor 37, Prosaposin receptor GPR37, Parkin-associated endothelin receptor-like receptor, GPR37, PAELR, ETBR-LP-1
Reference ARO-P11357
Note For research use only.
Molecular Constructor
Arg401–Leu443

Introduction to Recombinant Human GPR37 Protein

Recombinant Human GPR37 Protein is a protein that is produced through genetic engineering techniques, specifically recombinant DNA technology. It is a member of the G protein-coupled receptor (GPCR) family, which are important signaling molecules involved in a variety of physiological processes. GPR37 is a unique member of this family, as it is predominantly expressed in the nervous system and has been implicated in neurodegenerative diseases such as Parkinson’s disease. In this article, we will explore the structure, activity, and potential applications of this protein.

Structure of Recombinant Human GPR37 Protein

The gene encoding GPR37 is located on human chromosome 7 and is composed of 13 exons. The protein itself consists of 609 amino acids and has a predicted molecular weight of 67 kDa. It is a transmembrane protein, with seven transmembrane domains that span the cell membrane. The N-terminus of the protein is located on the extracellular side of the membrane, while the C-terminus is located on the intracellular side. This structural arrangement is typical of GPCRs and is essential for their function.

Recombinant Human GPR37 Protein is produced by inserting the gene encoding GPR37 into a suitable expression vector, such as a bacterial or mammalian cell expression system. The protein is then expressed and purified, typically using affinity chromatography techniques. This results in a highly pure and biologically active protein that can be used for various applications.

Activity of Recombinant Human GPR37 Protein

GPR37 is a GPCR that is activated by a specific ligand, the prosaposin-derived peptide prosaptide. When prosaptide binds to GPR37, it triggers a signaling cascade that leads to the activation of various downstream pathways. One of these pathways is the G protein-coupled receptor kinase (GRK)/β-arrestin pathway, which is involved in regulating GPCR activity and desensitization. GPR37 has also been shown to interact with other proteins, such as the dopamine transporter, and may play a role in regulating dopamine signaling in the brain.

The activity of GPR37 is not fully understood, but it has been implicated in various physiological processes. Studies have shown that GPR37 is highly expressed in the brain, particularly in the substantia nigra, a region that is affected in Parkinson’s disease. It has been suggested that GPR37 may play a role in the maintenance of dopaminergic neurons and may be involved in the pathogenesis of Parkinson’s disease. Additionally, GPR37 has been linked to other neurological disorders, such as Alzheimer’s disease, and may also play a role in immune system regulation.

Applications of Recombinant Human GPR37 Protein

Recombinant Human GPR37 Protein has potential applications in both research and therapeutics. As a research tool, it can be used to study the structure and function of GPR37 and its interactions with other proteins. It can also be used to investigate the role of GPR37 in various physiological processes and disease states. Furthermore, recombinant GPR37 can be used to develop high-throughput screening assays for potential GPR37-targeted drugs.

In terms of therapeutics, GPR37 has been identified as a potential target for the treatment of Parkinson’s disease. Recombinant Human GPR37 Protein can be used to develop drugs that target this receptor and modulate its activity. Additionally, GPR37 may have potential applications in other neurological disorders and immune-related diseases, making it a promising target for drug development.

Conclusion

In conclusion, Recombinant Human GPR37 Protein is a unique member of the GPCR family that has been implicated in various physiological processes and disease states. Its structure and activity make it a valuable research tool and a potential target for ther

Recombinant Human GPR37 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human GPR37 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products