Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FOSL2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P15408
Molecular weight:
35.57 kDa

Original price was: €297.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Arg127–His187
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FOSL2 Protein, N-GST & C-His

Product name ARO-P11300-100
Uniprot ID P15408
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAH
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg127-His187
Aliases /Synonyms FOSL2, Fos-related antigen 2, FRA-2, FRA2
Reference ARO-P11300
Note For research use only.
Molecular Constructor
Arg127–His187
Product name ARO-P11300-1MG
Uniprot ID P15408
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAH
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg127-His187
Aliases /Synonyms FOSL2, Fos-related antigen 2, FRA-2, FRA2
Reference ARO-P11300
Note For research use only.
Molecular Constructor
Arg127–His187
Product name ARO-P11300-50
Uniprot ID P15408
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAH
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg127-His187
Aliases /Synonyms FOSL2, Fos-related antigen 2, FRA-2, FRA2
Reference ARO-P11300
Note For research use only.
Molecular Constructor
Arg127–His187

Introduction

The Recombinant Human FOSL2 Protein is a synthetic protein that is produced in a laboratory using recombinant DNA technology. It is a highly purified form of the human FOSL2 protein, which is a transcription factor involved in cell growth and differentiation. This protein has been extensively studied for its structure, activity, and potential applications in various fields of research and medicine.

Structure of Recombinant Human FOSL2 Protein

The Recombinant Human FOSL2 Protein is composed of 132 amino acids and has a molecular weight of approximately 14.9 kDa. It is a member of the FOS family of transcription factors, which are known for their role in regulating gene expression. The protein contains a basic leucine zipper (bZIP) domain, which is responsible for its DNA binding activity. The bZIP domain is composed of a basic region that binds to specific DNA sequences and a leucine zipper region that mediates dimerization with other proteins.

The crystal structure of Recombinant Human FOSL2 Protein has been determined, revealing the three-dimensional arrangement of its amino acids. The protein has a helix-turn-helix structure, with the basic region forming an alpha helix and the leucine zipper region forming a coiled coil structure. This structure allows the protein to interact with specific DNA sequences and other proteins, thereby regulating gene expression.

Activity of Recombinant Human FOSL2 Protein

The primary function of Recombinant Human FOSL2 Protein is to regulate gene expression by binding to specific DNA sequences and activating or repressing the transcription of target genes. It is known to interact with other transcription factors, such as Jun proteins, to form a complex that binds to DNA and regulates the expression of target genes. This protein has been shown to play a crucial role in cell growth, differentiation, and development.

Studies have also demonstrated that Recombinant Human FOSL2 Protein is involved in various cellular processes, including cell cycle progression, apoptosis, and cell migration. It has been shown to play a role in the development of various tissues and organs, such as bone, muscle, and brain. Dysregulation of FOSL2 expression has been linked to several diseases, including cancer and developmental disorders.

Applications of Recombinant Human FOSL2 Protein

The unique properties of Recombinant Human FOSL2 Protein make it a valuable tool for various applications in research and medicine. Its ability to regulate gene expression and interact with other proteins makes it a useful tool for studying the molecular mechanisms of various diseases. It has been used in studies to understand the role of FOSL2 in cancer development and progression, as well as in the development of new therapeutic strategies.

Recombinant Human FOSL2 Protein has also been utilized in the development of diagnostic tests for various diseases. Its ability to bind to specific DNA sequences makes it a useful antigen for detecting the presence of FOSL2 in biological samples. This has potential applications in cancer diagnosis and monitoring, as well as in the diagnosis of developmental disorders.

Furthermore, Recombinant Human FOSL2 Protein has been studied for its potential therapeutic applications. It has been shown to have anti-tumor effects in certain types of cancer, and its role in cell differentiation and development makes it a potential target for regenerative medicine. Research is ongoing to explore the therapeutic potential of this protein in various diseases.

Conclusion

The Recombinant Human FOSL2 Protein is a highly purified form of the human FOSL2 protein, with a well-defined structure and activity. It plays a crucial role in regulating gene expression and has diverse applications in research and medicine. Further studies on this protein are expected to reveal new insights into its functions and potential therapeutic applications.

Recombinant Human FOSL2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human FOSL2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products