Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human FGL1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q08830
Molecular weight:
36.32 kDa

Original price was: €423.00.Current price is: €325.00.

100ug 23% OFF + 325 loyalty points
His Leu23–Ile312
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human FGL1 Protein, N-His

Recombinant Human FGL1 Protein, N-His

Product name ARO-P15109-100
Uniprot ID Q08830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Molecular weight 36.32 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu23-Ile312
Aliases /Synonyms Liver fibrinogen-related protein 1, HFREP-1, HP-041, Hepatocyte-derived fibrinogen-related protein 1, HPS, FGL1, LFIRE-1, Hepassocin, Fibrinogen-like protein 1, HFREP1
Reference ARO-P15109
Note For research use only.
Molecular Constructor
His Leu23–Ile312
Product name ARO-P15109-1MG
Uniprot ID Q08830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Molecular weight 36.32 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu23-Ile312
Aliases /Synonyms Liver fibrinogen-related protein 1, HFREP-1, HP-041, Hepatocyte-derived fibrinogen-related protein 1, HPS, FGL1, LFIRE-1, Hepassocin, Fibrinogen-like protein 1, HFREP1
Reference ARO-P15109
Note For research use only.
Molecular Constructor
His Leu23–Ile312
Product name ARO-P15109-50
Uniprot ID Q08830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Molecular weight 36.32 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu23-Ile312
Aliases /Synonyms Liver fibrinogen-related protein 1, HFREP-1, HP-041, Hepatocyte-derived fibrinogen-related protein 1, HPS, FGL1, LFIRE-1, Hepassocin, Fibrinogen-like protein 1, HFREP1
Reference ARO-P15109
Note For research use only.
Molecular Constructor
His Leu23–Ile312

There are no reviews yet.

Be the first to review “Recombinant Human FGL1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

  • SDS-PAGE for Anti-Human FGL1 (SH-07)

    PTX26412

    Anti-Human FGL1 (SH-07)

    Original price was: €481.00.Current price is: €379.00.
    View Product

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products