Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EIF4E3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N5X7
Molecular weight:
21.04 kDa

Original price was: €349.00.Current price is: €275.00.

100ug 21% OFF + 275 loyalty points
Ser51–His215
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EIF4E3 Protein, N-His

Product name ARO-P12688-100
Uniprot ID Q8N5X7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHH
Molecular weight 21.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser51-His215
Aliases /Synonyms eIF4E-3, Eukaryotic translation initiation factor 4E type 3, eIF-4E type 3, eIF-4E3, EIF4E3, eIF4E type 3
Reference ARO-P12688
Note For research use only.
Molecular Constructor
Ser51–His215
Product name ARO-P12688-1MG
Uniprot ID Q8N5X7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHH
Molecular weight 21.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser51-His215
Aliases /Synonyms eIF4E-3, Eukaryotic translation initiation factor 4E type 3, eIF-4E type 3, eIF-4E3, EIF4E3, eIF4E type 3
Reference ARO-P12688
Note For research use only.
Molecular Constructor
Ser51–His215
Product name ARO-P12688-50
Uniprot ID Q8N5X7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSWTFWLDRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHH
Molecular weight 21.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser51-His215
Aliases /Synonyms eIF4E-3, Eukaryotic translation initiation factor 4E type 3, eIF-4E type 3, eIF-4E3, EIF4E3, eIF4E type 3
Reference ARO-P12688
Note For research use only.
Molecular Constructor
Ser51–His215

Introduction to Recombinant Human EIF4E3 Protein

Recombinant Human EIF4E3 Protein, also known as Eukaryotic Translation Initiation Factor 4E3, is a protein that plays a crucial role in the initiation of protein synthesis in eukaryotic cells. It is a member of the EIF4E family, which consists of three isoforms: EIF4E1, EIF4E2, and EIF4E3. This protein is encoded by the EIF4E3 gene and is highly conserved across different species, indicating its importance in cellular processes.

Structure of Recombinant Human EIF4E3 Protein

The Recombinant Human EIF4E3 Protein is composed of 256 amino acids and has a molecular weight of approximately 29 kDa. It contains a conserved N-terminal domain, known as the EIF4E domain, which is responsible for binding to the 5′ cap structure of mRNA. This binding is essential for the recruitment of the ribosome and the initiation of protein translation.

In addition to the EIF4E domain, Recombinant Human EIF4E3 Protein also contains a C-terminal domain that is unique to this isoform. This domain is responsible for its specific functions and interactions with other proteins. Studies have shown that this domain is involved in the regulation of mRNA translation and the formation of stress granules, which are cytoplasmic structures that play a role in cellular stress response.

Activity of Recombinant Human EIF4E3 Protein

The main activity of Recombinant Human EIF4E3 Protein is its role in the initiation of protein synthesis. This protein binds to the 5′ cap structure of mRNA and helps in the recruitment of the ribosome, which is responsible for translating the mRNA into a protein. This process is essential for the production of all proteins in eukaryotic cells and is regulated by various factors, including the availability of Recombinant Human EIF4E3 Protein.

Recent studies have also shown that Recombinant Human EIF4E3 Protein plays a role in the regulation of gene expression. It has been found to interact with various proteins involved in mRNA translation, such as eIF4G and eIF4A. This interaction is crucial for the proper functioning of the translation machinery and the regulation of gene expression.

Moreover, Recombinant Human EIF4E3 Protein has been shown to play a role in the formation of stress granules. These structures are formed in response to cellular stress, such as heat shock, oxidative stress, or viral infection. Recombinant Human EIF4E3 Protein is involved in the recruitment of other proteins to these stress granules, which helps in the sequestration of mRNAs and the regulation of their translation.

Application of Recombinant Human EIF4E3 Protein

Due to its crucial role in protein synthesis and gene expression, Recombinant Human EIF4E3 Protein has various applications in scientific research. One of its main uses is in studying the regulation of translation and its role in various cellular processes. Recombinant Human EIF4E3 Protein can be used to study the formation of stress granules and its involvement in cellular stress response.

Furthermore, Recombinant Human EIF4E3 Protein has been found to be overexpressed in certain types of cancer, such as breast cancer and lung cancer. This overexpression has been linked to increased cell proliferation and tumor growth. Therefore, Recombinant Human EIF4E3 Protein can also be used as a potential target for cancer therapy.

In addition, Recombinant Human EIF4E3 Protein has been studied as a potential biomarker for certain diseases, including Alzheimer’s disease and Parkinson’s disease. Its involvement in protein synthesis and gene expression makes it a promising candidate for the early detection and diagnosis of these diseases.

Conclusion

In summary, Recombinant Human EIF4E

Recombinant Human EIF4E3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EIF4E3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products