Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DDX3X Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O00571
Molecular weight:
30.58 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Glu161–Ser410
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DDX3X Protein, N-His

Product name ARO-P11851-100
Uniprot ID O00571
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGS
Molecular weight 30.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu161-Ser410
Aliases /Synonyms DEAD box, X isoform, CAP-Rf, DDX3, HLP2, DEAD box protein 3, X-chromosomal, DDX3X, ATP-dependent RNA helicase DDX3X, Helicase-like protein 2, DBX
Reference ARO-P11851
Note For research use only.
Molecular Constructor
Glu161–Ser410
Product name ARO-P11851-1MG
Uniprot ID O00571
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGS
Molecular weight 30.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu161-Ser410
Aliases /Synonyms DEAD box, X isoform, CAP-Rf, DDX3, HLP2, DEAD box protein 3, X-chromosomal, DDX3X, ATP-dependent RNA helicase DDX3X, Helicase-like protein 2, DBX
Reference ARO-P11851
Note For research use only.
Molecular Constructor
Glu161–Ser410
Product name ARO-P11851-50
Uniprot ID O00571
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGS
Molecular weight 30.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu161-Ser410
Aliases /Synonyms DEAD box, X isoform, CAP-Rf, DDX3, HLP2, DEAD box protein 3, X-chromosomal, DDX3X, ATP-dependent RNA helicase DDX3X, Helicase-like protein 2, DBX
Reference ARO-P11851
Note For research use only.
Molecular Constructor
Glu161–Ser410

Structure of Recombinant Human DDX3X Protein

The Recombinant Human DDX3X Protein is a highly conserved ATP-dependent RNA helicase that belongs to the DEAD-box family of proteins. It is encoded by the DDX3X gene and is composed of 662 amino acids with a molecular weight of approximately 73 kDa. The protein contains several domains, including a DEAD-box domain, a helicase C-terminal domain, and a N-terminal domain. These domains play a crucial role in the protein’s function as an RNA helicase.

Activity of Recombinant Human DDX3X Protein

The primary function of Recombinant Human DDX3X Protein is to unwind RNA duplexes in an ATP-dependent manner. It binds to single-stranded RNA and uses the energy from ATP hydrolysis to unwind the RNA, allowing for the formation of RNA secondary structures. This activity is essential for various cellular processes, including RNA splicing, translation, and RNA degradation. Additionally, the protein has been shown to play a role in viral replication, making it a potential target for antiviral therapies.

Application of Recombinant Human DDX3X Protein

Recombinant Human DDX3X Protein has a wide range of applications in both research and medical fields. Its role as an RNA helicase makes it a valuable tool for studying RNA-protein interactions and RNA processing pathways. The protein has also been implicated in various diseases, such as cancer and viral infections, making it a potential therapeutic target.

Research Applications

  • RNA-Protein Interactions: Recombinant Human DDX3X Protein can be used in vitro to study its interactions with RNA molecules, providing valuable insights into its role in RNA processing pathways.
  • RNA Helicase Assays: The protein’s helicase activity can be measured using fluorescence-based assays, allowing for the screening of potential inhibitors or activators.
  • Structural Studies: Recombinant Human DDX3X Protein can be used for X-ray crystallography and nuclear magnetic resonance (NMR) studies to determine its three-dimensional structure and understand its mechanism of action.

Medical Applications

  • Cancer: DDX3X has been found to be overexpressed in various types of cancer, including breast, lung, and liver cancer. Recombinant Human DDX3X Protein can be used to study its role in cancer progression and as a potential therapeutic target.
  • Viral Infections: The protein has been shown to play a crucial role in the replication of several viruses, including HIV and hepatitis C virus. Recombinant Human DDX3X Protein can be used to study the virus-host interactions and develop antiviral therapies.
  • Gene Therapy: Recombinant Human DDX3X Protein can be used as a delivery vehicle for gene therapy, as it has been shown to efficiently deliver siRNA and other small molecules into cells.

Conclusion

In summary, Recombinant Human DDX3X Protein is a highly conserved RNA helicase with a crucial role in various cellular processes. Its structure and activity make it a valuable tool for studying RNA-protein interactions and RNA processing pathways. Additionally, its involvement in cancer and viral infections makes it a potential target for therapeutic interventions. With its wide range of applications, Recombinant Human DDX3X Protein continues to be a crucial protein in the field of molecular biology and medicine.

</body

Recombinant Human DDX3X Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DDX3X Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products