Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HPS6 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86YV9
Molecular weight:
21.54 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Thr371–Met454
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HPS6 Protein, N-His-SUMO

Product name ARO-P11428-100
Uniprot ID Q86YV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Molecular weight 21.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr371-Met454
Aliases /Synonyms Ruby-eye protein homolog, HPS6, Ru, Hermansky-Pudlak syndrome 6 protein
Reference ARO-P11428
Note For research use only.
Molecular Constructor
Thr371–Met454
Product name ARO-P11428-1MG
Uniprot ID Q86YV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Molecular weight 21.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr371-Met454
Aliases /Synonyms Ruby-eye protein homolog, HPS6, Ru, Hermansky-Pudlak syndrome 6 protein
Reference ARO-P11428
Note For research use only.
Molecular Constructor
Thr371–Met454
Product name ARO-P11428-50
Uniprot ID Q86YV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Molecular weight 21.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr371-Met454
Aliases /Synonyms Ruby-eye protein homolog, HPS6, Ru, Hermansky-Pudlak syndrome 6 protein
Reference ARO-P11428
Note For research use only.
Molecular Constructor
Thr371–Met454

Introduction

Recombinant Human HPS6 Protein, also known as HPS6, is a highly conserved protein that plays a crucial role in the biogenesis of lysosome-related organelles. It is a member of the Hermansky-Pudlak Syndrome (HPS) protein family and is encoded by the HPS6 gene. HPS6 is involved in the formation of intracellular organelles such as melanosomes, platelet dense granules, and lysosomes. In this article, we will discuss the structure, activity, and application of Recombinant Human HPS6 Protein.

Structure of Recombinant Human HPS6 Protein

Recombinant Human HPS6 Protein is a 115-kDa protein consisting of 1,015 amino acids. It is composed of multiple domains, including a coiled-coil domain, a WD40 repeat domain, and a C-terminal domain. The coiled-coil domain is responsible for protein-protein interactions, while the WD40 repeat domain is involved in protein-protein interactions and protein-DNA interactions. The C-terminal domain contains a conserved motif that is essential for the localization of HPS6 to lysosome-related organelles.

Activity of Recombinant Human HPS6 Protein

HPS6 is primarily involved in the biogenesis of lysosome-related organelles. It is required for the proper trafficking of proteins to these organelles and plays a crucial role in the formation of their characteristic morphology. HPS6 interacts with other HPS proteins, such as HPS1, HPS4, and HPS5, to form a complex that is essential for the proper function of lysosome-related organelles.

Studies have shown that mutations in the HPS6 gene can lead to Hermansky-Pudlak Syndrome, a rare genetic disorder characterized by abnormal pigmentation, bleeding disorders, and lung fibrosis. This further highlights the importance of HPS6 in the biogenesis of lysosome-related organelles and its role in maintaining cellular homeostasis.

Application of Recombinant Human HPS6 Protein

Recombinant Human HPS6 Protein has various applications in the field of cell biology and medicine. It can be used in research studies to understand the mechanisms involved in the biogenesis of lysosome-related organelles. Recombinant HPS6 protein can also be used to study the pathophysiology of Hermansky-Pudlak Syndrome and other related disorders.

Furthermore, Recombinant Human HPS6 Protein has potential therapeutic applications. Mutations in the HPS6 gene have been linked to various disorders, and the use of recombinant HPS6 protein may help in the development of targeted therapies for these conditions. Additionally, HPS6 has been shown to interact with other proteins involved in lysosome-related organelle biogenesis, making it a potential target for drug development.

Conclusion

In summary, Recombinant Human HPS6 Protein is a crucial protein involved in the biogenesis of lysosome-related organelles. It plays a vital role in maintaining cellular homeostasis and is essential for the proper function of these organelles. Recombinant HPS6 protein has various applications in research and medicine, and its study may lead to a better understanding of related disorders and the development of targeted therapies.

Recombinant Human HPS6 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human HPS6 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products