Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Eldelumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Eldelumab ELISA Kit

Eldelumab ELISA Kit

Product name Eldelumab ELISA Kit
Uniprot ID P02778
Raw Antigen Sequence MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX139
Note For research use only.
Sample type Plasma, Serum
Target Eldelumab
Immunogen Eldelumab

Introduction

Eldelumab is a monoclonal antibody that has been developed as a therapeutic agent for the treatment of inflammatory diseases. It works by targeting a specific protein called interleukin-6 (IL-6), which is known to play a key role in the development and progression of various inflammatory conditions. The Eldelumab ELISA Kit is a highly sensitive and specific tool that is used for the quantitative measurement of Eldelumab in biological samples. In this article, we will discuss the structure, activity, and applications of the Eldelumab ELISA Kit.

Structure of Eldelumab

Eldelumab is a humanized monoclonal antibody that is produced by recombinant DNA technology. It consists of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the target protein, IL-6. The constant regions provide stability and effector functions to the antibody. The Eldelumab ELISA Kit utilizes specific antibodies that are designed to recognize and bind to the unique structure of Eldelumab, allowing for its detection and quantification in biological samples.

Activity of Eldelumab

Eldelumab works by binding to IL-6 and preventing it from interacting with its receptor, thus inhibiting its pro-inflammatory effects. IL-6 is a cytokine that is produced by various cells in the body in response to inflammation. It plays a crucial role in the immune response, but excessive levels of IL-6 have been linked to the development of chronic inflammatory diseases such as rheumatoid arthritis and Crohn’s disease. By blocking the activity of IL-6, Eldelumab helps to reduce inflammation and alleviate the symptoms of these diseases.

Application of Eldelumab ELISA Kit

The Eldelumab ELISA Kit is primarily used for the quantitative measurement of Eldelumab in serum or plasma samples. It is a valuable tool for researchers and clinicians who are studying the pharmacokinetics and pharmacodynamics of Eldelumab and its effects on IL-6 levels. The kit is also used in clinical trials to monitor the efficacy of Eldelumab treatment in patients with inflammatory diseases. Additionally, the Eldelumab ELISA Kit can be used to assess the presence of anti-drug antibodies (ADAs) in patients receiving Eldelumab therapy. ADAs can potentially interfere with the activity of Eldelumab and may impact its effectiveness in treating inflammatory conditions.

Advantages of Eldelumab ELISA Kit

The Eldelumab ELISA Kit offers several advantages over other methods of detecting and quantifying Eldelumab. It is a highly sensitive and specific assay, with a lower limit of detection of 0.1 ng/mL. It also has a wide dynamic range, allowing for the measurement of both low and high levels of Eldelumab in biological samples. The kit is easy to use and provides rapid results, making it a convenient tool for researchers and clinicians. Furthermore, the Eldelumab ELISA Kit has been validated for use with multiple sample types, including serum, plasma, and cell culture supernatants.

Conclusion

In summary, the Eldelumab ELISA Kit is a valuable tool for the detection and quantification of Eldelumab in biological samples. Its high sensitivity and specificity make it a reliable method for monitoring Eldelumab levels in patients receiving treatment for inflammatory diseases. The kit’s ease of use and rapid results make it a convenient option for researchers and clinicians. With the increasing use of Eldelumab as a therapeutic agent, the Eldelumab ELISA Kit will continue to play a crucial role in the development and evaluation of this promising treatment.

Eldelumab ELISA Kit

There are no reviews yet.

Be the first to review “Eldelumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products