Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HES5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5TA89
Molecular weight:
16.10 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Met1–Arg121
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HES5 Protein, N-His

Product name ARO-P11660-100
Uniprot ID Q5TA89
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
Molecular weight 16.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg121
Aliases /Synonyms BHLHB38, Transcription factor HES-5, Class B basic helix-loop-helix protein 38, bHLHb38, Hairy and enhancer of split 5, HES5
Reference ARO-P11660
Note For research use only.
Molecular Constructor
Met1–Arg121
Product name ARO-P11660-1MG
Uniprot ID Q5TA89
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
Molecular weight 16.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg121
Aliases /Synonyms BHLHB38, Transcription factor HES-5, Class B basic helix-loop-helix protein 38, bHLHb38, Hairy and enhancer of split 5, HES5
Reference ARO-P11660
Note For research use only.
Molecular Constructor
Met1–Arg121
Product name ARO-P11660-50
Uniprot ID Q5TA89
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
Molecular weight 16.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg121
Aliases /Synonyms BHLHB38, Transcription factor HES-5, Class B basic helix-loop-helix protein 38, bHLHb38, Hairy and enhancer of split 5, HES5
Reference ARO-P11660
Note For research use only.
Molecular Constructor
Met1–Arg121

Introduction to Recombinant Human HES5 Protein

Recombinant Human HES5 Protein, also known as Human Hairy and Enhancer of Split 5, is a protein that plays a crucial role in regulating cell differentiation and development. It belongs to the HES family of transcription factors, which are known to be involved in various cellular processes such as proliferation, differentiation, and apoptosis.

Structure of Recombinant Human HES5 Protein

Recombinant Human HES5 Protein is a 291 amino acid long protein with a molecular weight of approximately 33 kDa. It contains a basic helix-loop-helix (bHLH) domain, which is responsible for its DNA-binding activity, and an orange domain, which is involved in protein-protein interactions. The bHLH domain is highly conserved among all members of the HES family and is essential for their function.

Recombinant Human HES5 Protein is produced through recombinant DNA technology, where the gene encoding for the protein is inserted into a suitable expression vector and then expressed in a host cell, typically E. coli or mammalian cells. This allows for the production of large quantities of pure and biologically active protein.

Activity of Recombinant Human HES5 Protein

Recombinant Human HES5 Protein acts as a transcription factor, meaning it binds to specific DNA sequences and regulates the expression of target genes. It is known to interact with Notch signaling pathway components, including Notch receptors and co-receptors, and plays a crucial role in modulating their activity. This interaction leads to the repression of target gene expression, thereby regulating cell fate determination and differentiation.

Studies have also shown that Recombinant Human HES5 Protein can inhibit the proliferation of neural stem cells and promote their differentiation into neurons. It has been suggested that this protein may play a role in maintaining the balance between self-renewal and differentiation of neural stem cells, which is crucial for proper brain development.

Applications of Recombinant Human HES5 Protein

Recombinant Human HES5 Protein has various applications in both research and therapeutic settings. Its ability to regulate cell differentiation and proliferation makes it a valuable tool in studying the development of various tissues and organs, particularly the brain. It has also been used in studies investigating the role of Notch signaling in cancer, as dysregulation of this pathway has been linked to several types of cancer.

In addition, Recombinant Human HES5 Protein has potential therapeutic applications. It has been shown to promote the differentiation of neural stem cells into neurons, making it a potential treatment for neurological disorders such as Alzheimer’s and Parkinson’s disease. It has also been suggested that this protein may have a role in promoting the regeneration of damaged nerve cells.

Conclusion

In summary, Recombinant Human HES5 Protein is a crucial transcription factor involved in regulating cell differentiation and development. Its structure, activity, and applications make it a valuable tool in understanding various cellular processes and potential therapeutic interventions. Further research on this protein may lead to a better understanding of its role in disease and the development of novel treatments.

Recombinant Human HES5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HES5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products