Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PTPRN, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q16849
Molecular weight:
21.96 kDa

Original price was: €299.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Met389–Arg575
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PTPRN, N-His

Product name ARO-P13319-100
Uniprot ID Q16849
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMR
Molecular weight 21.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met389-Arg575
Aliases /Synonyms ICA512-TMF, ICA512-CCF, Receptor-type tyrosine-protein phosphatase-like N, Islet cell autoantigen 3, ICA512, PTPRN, Islet cell antigen 512, ICA 512, PTP IA-2, ICA3, ICA512-NTF, R-PTP-N
Reference ARO-P13319
Note For research use only.
Molecular Constructor
Met389–Arg575
Product name ARO-P13319-1MG
Uniprot ID Q16849
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMR
Molecular weight 21.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met389-Arg575
Aliases /Synonyms ICA512-TMF, ICA512-CCF, Receptor-type tyrosine-protein phosphatase-like N, Islet cell autoantigen 3, ICA512, PTPRN, Islet cell antigen 512, ICA 512, PTP IA-2, ICA3, ICA512-NTF, R-PTP-N
Reference ARO-P13319
Note For research use only.
Molecular Constructor
Met389–Arg575
Product name ARO-P13319-50
Uniprot ID Q16849
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMR
Molecular weight 21.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met389-Arg575
Aliases /Synonyms ICA512-TMF, ICA512-CCF, Receptor-type tyrosine-protein phosphatase-like N, Islet cell autoantigen 3, ICA512, PTPRN, Islet cell antigen 512, ICA 512, PTP IA-2, ICA3, ICA512-NTF, R-PTP-N
Reference ARO-P13319
Note For research use only.
Molecular Constructor
Met389–Arg575

Introduction to Recombinant Human PTPRN

Recombinant Human PTPRN, also known as Recombinant Protein Tyrosine Phosphatase Receptor N, is a protein that plays a critical role in regulating cell signaling and communication. It is a member of the protein tyrosine phosphatase (PTP) family, which are enzymes that remove phosphate groups from specific tyrosine residues in proteins. PTPRN is involved in a variety of cellular processes such as cell growth, differentiation, and metabolism, making it an important target for research and therapeutic applications.

Structure of Recombinant Human PTPRN

Recombinant Human PTPRN is a 120 kDa protein consisting of 1052 amino acids. It is composed of a single catalytic domain and an extracellular region containing fibronectin type III repeats. The catalytic domain contains a conserved signature motif, HCXXGXXRS/T, which is essential for its phosphatase activity. The extracellular region of PTPRN contains six fibronectin type III repeats, which are involved in protein-protein interactions and play a role in the regulation of PTPRN activity.

Activity of Recombinant Human PTPRN

Recombinant Human PTPRN is a highly active protein tyrosine phosphatase, with a specific activity of 1000-2000 units/mg. It has been shown to dephosphorylate a wide range of substrates, including receptor tyrosine kinases, non-receptor tyrosine kinases, and other signaling molecules. PTPRN is involved in both positive and negative regulation of signaling pathways, depending on the substrate and cellular context. It can dephosphorylate both phosphotyrosine and phosphothreonine residues, making it a versatile regulator of cellular signaling.

Application of Recombinant Human PTPRN

Due to its crucial role in regulating cellular processes, Recombinant Human PTPRN has a wide range of applications in both research and therapeutic fields. Here are some of the key applications of this protein:

1. Research

Recombinant Human PTPRN is widely used in research to study its role in various cellular processes. Its activity can be modulated using specific inhibitors or activators, allowing researchers to investigate the effects of PTPRN on different signaling pathways. It can also be used to study the interaction between PTPRN and its substrates, providing insights into the mechanisms of PTPRN-mediated signaling regulation.

2. Therapeutics

PTPRN has been identified as a potential therapeutic target for a variety of diseases, including cancer, diabetes, and autoimmune disorders. Recombinant Human PTPRN can be used to develop specific inhibitors that can selectively block its activity, providing a potential treatment for diseases caused by dysregulated PTPRN activity. Additionally, PTPRN inhibitors can also be used as adjuvants in cancer therapy to enhance the efficacy of existing treatments.

3. Diagnostic Tool

PTPRN has been shown to be dysregulated in various diseases, making it a potential biomarker for diagnostic purposes. Recombinant Human PTPRN can be used to develop diagnostic assays to detect the levels of PTPRN in patient samples, allowing for early detection and monitoring of diseases such as cancer and diabetes.

4. Vaccine Development

Recombinant Human PTPRN has also been explored as a potential vaccine candidate. It has been shown to be a highly immunogenic antigen, capable of eliciting a strong immune response in animal models. PTPRN-based vaccines have shown promising results in preclinical studies for diseases such as diabetes and autoimmune disorders, and further research is ongoing to develop PTPRN-based vaccines for other diseases.

Conclusion

Recombinant Human PTPRN, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PTPRN, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products