Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CHRNA6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15825
Molecular weight:
23.98 kDa

Original price was: €288.00.Current price is: €230.00.

50ug 20% OFF + 230 loyalty points
Val55–Arg238
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CHRNA6 Protein, N-His

Product name ARO-P11267-100
Uniprot ID Q15825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRR
Molecular weight 23.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val55-Arg238
Aliases /Synonyms CHRNA6, Neuronal acetylcholine receptor subunit alpha-6
Reference ARO-P11267
Note For research use only.
Molecular Constructor
Val55–Arg238
Product name ARO-P11267-1MG
Uniprot ID Q15825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRR
Molecular weight 23.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val55-Arg238
Aliases /Synonyms CHRNA6, Neuronal acetylcholine receptor subunit alpha-6
Reference ARO-P11267
Note For research use only.
Molecular Constructor
Val55–Arg238
Product name ARO-P11267-50
Uniprot ID Q15825
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRR
Molecular weight 23.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val55-Arg238
Aliases /Synonyms CHRNA6, Neuronal acetylcholine receptor subunit alpha-6
Reference ARO-P11267
Note For research use only.
Molecular Constructor
Val55–Arg238

Introduction

Recombinant Human CHRNA6 Protein, also known as Cholinergic Receptor Nicotinic Alpha 6 Subunit (CHRNA6), is a protein that plays a crucial role in the nervous system. It is a member of the nicotinic acetylcholine receptor (nAChR) family, which are ligand-gated ion channels that mediate fast synaptic transmission in the central and peripheral nervous systems. CHRNA6 is highly expressed in the brain, particularly in the hippocampus, thalamus, and cerebellum, and is involved in various physiological processes such as learning, memory, and motor coordination.

Structure of Recombinant Human CHRNA6 Protein

Recombinant Human CHRNA6 Protein is a 55 kDa protein that is composed of 496 amino acids. It is a transmembrane protein with four subunits, each containing a large extracellular domain, a transmembrane domain, and a short intracellular domain. The extracellular domain is responsible for binding to the neurotransmitter acetylcholine, while the transmembrane domain forms the pore through which ions can pass. The intracellular domain is involved in signaling and regulation of the receptor activity.

Activity of Recombinant Human CHRNA6 Protein

Recombinant Human CHRNA6 Protein functions as a ligand-gated ion channel, meaning it opens in response to the binding of a specific ligand, in this case, acetylcholine. When acetylcholine binds to the extracellular domain of the receptor, it causes a conformational change that opens the channel, allowing the influx of positively charged ions such as sodium and calcium. This influx of ions results in the generation of an electrical signal, which is essential for the transmission of nerve impulses.

CHRNA6 is also involved in the regulation of neurotransmitter release. Studies have shown that activation of CHRNA6 inhibits the release of the neurotransmitter GABA, which is responsible for inhibitory signaling in the brain. This suggests that CHRNA6 plays a role in the balance of excitatory and inhibitory signaling in the brain, which is crucial for proper brain function.

Application of Recombinant Human CHRNA6 Protein

Recombinant Human CHRNA6 Protein has several applications in both research and medical fields. One of its primary uses is in studying the role of nAChRs in the nervous system. Researchers can use recombinant CHRNA6 protein to investigate the function of this specific receptor and its role in various physiological processes. This can provide valuable insights into the mechanisms underlying learning, memory, and motor coordination.

Another potential application of recombinant CHRNA6 protein is in drug discovery. As CHRNA6 is involved in neurotransmitter release and plays a role in the balance of excitatory and inhibitory signaling, it is a potential target for drug development. By studying the structure and activity of recombinant CHRNA6 protein, researchers can identify compounds that can modulate its activity and potentially treat neurological disorders such as epilepsy and schizophrenia.

Additionally, recombinant CHRNA6 protein can be used in diagnostic tests for certain neurological disorders. Mutations in the CHRNA6 gene have been linked to various neurological disorders, including autism spectrum disorder and attention deficit hyperactivity disorder (ADHD). By detecting these mutations, doctors can diagnose these disorders early and provide appropriate treatment.

Conclusion

Recombinant Human CHRNA6 Protein is a crucial component of the nervous system, involved in various physiological processes such as learning, memory, and motor coordination. Its structure as a ligand-gated ion channel and its role in neurotransmitter release make it a valuable tool for studying the nervous system and a potential target for drug development. With further research, recombinant CHRNA6 protein may also have clinical applications in diagnosing and treating neurological disorders.

Keywords: recombinant protein

Recombinant Human CHRNA6 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CHRNA6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products