Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human APMAP, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HDC9
Molecular weight:
27.79 kDa

Original price was: €305.00.Current price is: €275.00.

100ug 10% OFF + 275 loyalty points
Glu62–Leu289
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human APMAP, N-His

Product name ARO-P13085-100
Uniprot ID Q9HDC9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGL
Molecular weight 27.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu62-Leu289
Aliases /Synonyms Protein BSCv, APMAP, Adipocyte plasma membrane-associated protein, C20orf3
Reference ARO-P13085
Note For research use only.
Molecular Constructor
Glu62–Leu289
Product name ARO-P13085-1MG
Uniprot ID Q9HDC9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGL
Molecular weight 27.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu62-Leu289
Aliases /Synonyms Protein BSCv, APMAP, Adipocyte plasma membrane-associated protein, C20orf3
Reference ARO-P13085
Note For research use only.
Molecular Constructor
Glu62–Leu289
Product name ARO-P13085-50
Uniprot ID Q9HDC9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGL
Molecular weight 27.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu62-Leu289
Aliases /Synonyms Protein BSCv, APMAP, Adipocyte plasma membrane-associated protein, C20orf3
Reference ARO-P13085
Note For research use only.
Molecular Constructor
Glu62–Leu289

Introduction

Recombinant Human APMAP (Adipocyte Plasma Membrane-Associated Protein) is a protein that is encoded by the APMAP gene and is involved in various cellular processes. It is a highly conserved protein found in humans and other mammals, and has been extensively studied for its structure, activity, and potential applications in various fields of research.

Structure of Recombinant Human APMAP

The APMAP gene encodes a protein of 141 amino acids, with a predicted molecular weight of approximately 16 kDa. The protein consists of a signal peptide, a hydrophobic transmembrane domain, and a cytoplasmic region. The cytoplasmic region contains a proline-rich domain and a C-terminal PDZ-binding motif, which are important for its function.

Recombinant Human APMAP is produced through genetic engineering techniques, using recombinant DNA technology. The protein is expressed in a host cell, typically E. coli, and then purified using various chromatography techniques. The purified protein is highly stable and retains its biological activity.

Activity of Recombinant Human APMAP

APMAP has been shown to play a role in various cellular processes, including lipid metabolism, cell adhesion, and cytoskeleton organization. It is primarily expressed in adipocytes, where it localizes to the plasma membrane. Studies have also shown its expression in other tissues, such as the liver, kidney, and brain.

One of the key functions of APMAP is its involvement in lipid metabolism. It has been shown to interact with various enzymes involved in lipid metabolism, such as phospholipase A2 and diacylglycerol kinase, and regulate their activity. This suggests a potential role for APMAP in the regulation of lipid homeostasis and obesity.

APMAP has also been implicated in cell adhesion, as it interacts with the extracellular matrix protein fibronectin. This interaction may play a role in cell migration and tissue development. Additionally, APMAP has been shown to regulate the organization of the actin cytoskeleton, which is important for cell movement and shape.

Applications of Recombinant Human APMAP

The potential applications of Recombinant Human APMAP are vast, due to its diverse functions and interactions. One potential application is in the study of lipid metabolism and obesity. APMAP has been shown to regulate lipid metabolism and may serve as a potential therapeutic target for obesity and related metabolic disorders.

APMAP’s role in cell adhesion and cytoskeleton organization also makes it a potential target for cancer research. Aberrant cell adhesion and cytoskeleton organization are hallmarks of cancer, and APMAP’s involvement in these processes may provide new insights into cancer development and potential therapeutic interventions.

In addition, APMAP has been shown to interact with various proteins involved in signal transduction, suggesting a potential role in regulating cellular signaling pathways. This makes it a promising target for drug discovery and development.

Conclusion

In summary, Recombinant Human APMAP is a highly conserved protein with diverse functions and interactions. Its structure and activity have been extensively studied, and it has shown potential applications in various fields of research, including lipid metabolism, cell adhesion, and cancer. Further research on APMAP may provide valuable insights into its role in various cellular processes and its potential as a therapeutic target.

Recombinant Human APMAP, N-His

There are no reviews yet.

Be the first to review “Recombinant Human APMAP, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products