Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD233/SLC4A1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P02730
Molecular weight:
30.72 kDa

Original price was: €398.00.Current price is: €329.00.

100ug 17% OFF + 329 loyalty points
His Ala35–Ser290
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD233/SLC4A1, N-His

Product name ARO-P13722-100
Uniprot ID P02730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMS
Molecular weight 30.72 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser290
Aliases /Synonyms Anion exchange protein 1, Anion exchanger 1, EPB3, CD233, Band 3 anion transport protein, AE 1, DI, AE1, SLC4A1, Solute carrier family 4 member 1
Reference ARO-P13722
Note For research use only.
Molecular Constructor
His Ala35–Ser290
Product name ARO-P13722-1MG
Uniprot ID P02730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMS
Molecular weight 30.72 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser290
Aliases /Synonyms Anion exchange protein 1, Anion exchanger 1, EPB3, CD233, Band 3 anion transport protein, AE 1, DI, AE1, SLC4A1, Solute carrier family 4 member 1
Reference ARO-P13722
Note For research use only.
Molecular Constructor
His Ala35–Ser290
Product name ARO-P13722-50
Uniprot ID P02730
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMS
Molecular weight 30.72 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala35-Ser290
Aliases /Synonyms Anion exchange protein 1, Anion exchanger 1, EPB3, CD233, Band 3 anion transport protein, AE 1, DI, AE1, SLC4A1, Solute carrier family 4 member 1
Reference ARO-P13722
Note For research use only.
Molecular Constructor
His Ala35–Ser290

Introduction to Recombinant Human CD233/SLC4A1

Recombinant Human CD233/SLC4A1, also known as Band 3 or AE1, is a membrane protein that plays a crucial role in maintaining the acid-base balance and regulating the transport of carbon dioxide and chloride ions in the body. This protein is encoded by the SLC4A1 gene and is found on the surface of red blood cells, kidney cells, and other tissues. In this article, we will explore the structure, activity, and applications of Recombinant Human CD233/SLC4A1.

Structure of Recombinant Human CD233/SLC4A1

Recombinant Human CD233/SLC4A1 is a transmembrane protein with a molecular weight of approximately 100 kDa. It consists of 911 amino acids and has a complex structure with multiple domains and subunits. The protein is composed of two subunits, a 911 amino acid N-terminal domain and a 50 amino acid C-terminal domain, which are connected by a short linker region.

The N-terminal domain of Recombinant Human CD233/SLC4A1 contains 12 transmembrane segments and is responsible for the transport of carbon dioxide and chloride ions. The C-terminal domain, on the other hand, is involved in protein-protein interactions and plays a role in the regulation of the protein’s activity.

Activity of Recombinant Human CD233/SLC4A1

Recombinant Human CD233/SLC4A1 is primarily involved in the transport of carbon dioxide and chloride ions across the cell membrane. It acts as an anion exchanger and helps to maintain the acid-base balance in the body by exchanging bicarbonate ions for chloride ions. This process is essential for the proper functioning of various organs, including the lungs, kidneys, and digestive system.

In addition to its role in ion transport, Recombinant Human CD233/SLC4A1 also plays a crucial role in cell signaling and cell adhesion. It interacts with other proteins and receptors on the cell surface, thereby regulating various cellular processes such as cell growth, differentiation, and apoptosis.

Applications of Recombinant Human CD233/SLC4A1

Recombinant Human CD233/SLC4A1 has a wide range of applications in both research and clinical settings. One of the most significant applications of this protein is in the diagnosis and treatment of various diseases. Mutations in the SLC4A1 gene have been linked to several disorders, including hereditary spherocytosis, distal renal tubular acidosis, and certain types of anemia. Recombinant Human CD233/SLC4A1 can be used as an antigen in diagnostic tests to identify these genetic disorders.

Moreover, Recombinant Human CD233/SLC4A1 has also been used in the production of therapeutic proteins and vaccines. It has been successfully expressed in various expression systems, including mammalian cells, bacteria, and yeast, to produce recombinant proteins with enhanced stability and activity. This has led to the development of new treatments for diseases such as cystic fibrosis, sickle cell disease, and cancer.

Conclusion

In conclusion, Recombinant Human CD233/SLC4A1 is a vital protein with a complex structure and diverse functions. Its role in regulating ion transport, cell signaling, and adhesion makes it a crucial component of many physiological processes. With its various applications in research and medicine, Recombinant Human CD233/SLC4A1 continues to be a significant area of study and has the potential to improve the diagnosis and treatment of various diseases.

Recombinant Human CD233/SLC4A1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD233/SLC4A1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products