Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD163 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86VB7
Molecular weight:
39.51 kDa

Original price was: €226.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Arg476–Thr581
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD163 Protein, N-GST & C-His

Product name ARO-P11142-100
Uniprot ID Q86VB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REPRLVGGDIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQIWAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYT
Molecular weight 39.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg476-Thr581
Aliases /Synonyms Scavenger receptor cysteine-rich type 1 protein M130, M130, Hemoglobin scavenger receptor, CD163, sCD163
Reference ARO-P11142
Note For research use only.
Molecular Constructor
Arg476–Thr581
Product name ARO-P11142-1MG
Uniprot ID Q86VB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REPRLVGGDIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQIWAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYT
Molecular weight 39.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg476-Thr581
Aliases /Synonyms Scavenger receptor cysteine-rich type 1 protein M130, M130, Hemoglobin scavenger receptor, CD163, sCD163
Reference ARO-P11142
Note For research use only.
Molecular Constructor
Arg476–Thr581
Product name ARO-P11142-50
Uniprot ID Q86VB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REPRLVGGDIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQIWAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYT
Molecular weight 39.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg476-Thr581
Aliases /Synonyms Scavenger receptor cysteine-rich type 1 protein M130, M130, Hemoglobin scavenger receptor, CD163, sCD163
Reference ARO-P11142
Note For research use only.
Molecular Constructor
Arg476–Thr581

Introduction to Recombinant Human CD163 Protein

Recombinant Human CD163 Protein, also known as cluster of differentiation 163, is a type I transmembrane glycoprotein that belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. It is encoded by the CD163 gene and is expressed on the surface of monocytes and macrophages. CD163 plays a crucial role in the innate immune response and has been identified as a potential therapeutic target for various diseases. In this article, we will delve into the structure, activity, and applications of Recombinant Human CD163 Protein.

Structure of Recombinant Human CD163 Protein

The human CD163 gene is located on chromosome 12p13.3 and consists of 18 exons, which encode a protein of 1303 amino acids. The protein has a molecular weight of approximately 130 kDa and contains a short cytoplasmic tail, a transmembrane domain, and nine SRCR domains. The SRCR domains are responsible for the binding of various ligands, including hemoglobin-haptoglobin complexes, lipopolysaccharides, and bacteria. The extracellular domain of CD163 also contains a cysteine-rich region, which is important for maintaining the protein’s structure.

Activity of Recombinant Human CD163 Protein

CD163 is primarily expressed on the surface of monocytes and macrophages, where it functions as a scavenger receptor. It is involved in the clearance of hemoglobin-haptoglobin complexes, which are released during hemolysis. CD163 binds to the haptoglobin portion of the complex and internalizes it, preventing the release of iron and heme, which can be toxic. This process is crucial for maintaining iron homeostasis in the body.

In addition to its scavenging activity, CD163 also plays a role in modulating the immune response. It has been shown to have anti-inflammatory effects by inhibiting the production of pro-inflammatory cytokines, such as TNF-α and IL-6. CD163 also promotes the production of anti-inflammatory cytokines, such as IL-10, which helps to dampen the immune response. This function of CD163 is essential in preventing excessive inflammation and tissue damage.

Applications of Recombinant Human CD163 Protein

Recombinant Human CD163 Protein has numerous potential applications in both research and clinical settings. One of the most promising applications is in the treatment of inflammatory diseases. CD163 has been identified as a potential therapeutic target for conditions such as sepsis, atherosclerosis, and rheumatoid arthritis. By modulating the activity of CD163, it may be possible to reduce inflammation and prevent tissue damage in these diseases.

Another potential application of Recombinant Human CD163 Protein is in the field of regenerative medicine. CD163 has been shown to play a role in tissue repair and regeneration. Studies have demonstrated that CD163 is involved in the clearance of cellular debris and the promotion of tissue healing. This suggests that CD163 could be used to enhance tissue repair and regeneration in conditions such as wound healing and tissue injury.

Furthermore, Recombinant Human CD163 Protein has also been used in research studies as a diagnostic marker for various diseases. CD163 is highly expressed in certain types of cancer, such as multiple myeloma and acute myeloid leukemia. Its expression has been correlated with disease progression and prognosis, making it a potential biomarker for these cancers.

Conclusion

In summary, Recombinant Human CD163 Protein is a multifunctional protein with important roles in the immune response, iron homeostasis, and tissue repair. Its structure, activity, and potential applications make it a promising target for therapeutic interventions and diagnostic purposes. Further research on CD163 and its functions may lead to the development of novel treatments for various diseases.

Recombinant Human CD163 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CD163 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products