Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD125/IL5RA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q01344
Molecular weight:
18.31 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Gly42–Cys182
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD125/IL5RA Protein, N-His

Product name ARO-P12683-100
Uniprot ID Q01344
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEEC
Molecular weight 18.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Cys182
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P12683
Note For research use only.
Molecular Constructor
Gly42–Cys182
Product name ARO-P12683-1MG
Uniprot ID Q01344
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEEC
Molecular weight 18.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Cys182
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P12683
Note For research use only.
Molecular Constructor
Gly42–Cys182
Product name ARO-P12683-50
Uniprot ID Q01344
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEEC
Molecular weight 18.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly42-Cys182
Aliases /Synonyms IL-5R subunit alpha, IL-5 receptor subunit alpha, IL5RA, IL-5RA, IL-5R-alpha, Interleukin-5 receptor subunit alpha, CDw125, CD125, IL5R
Reference ARO-P12683
Note For research use only.
Molecular Constructor
Gly42–Cys182

Introduction

Recombinant Human CD125/IL5RA Protein, also known as Interleukin 5 receptor alpha (IL5RA), is a type I transmembrane protein that is involved in the immune system. It is a member of the cytokine receptor family and is primarily expressed on the surface of eosinophils, basophils, and mast cells. This protein plays a crucial role in the regulation of immune responses, particularly in the development and activation of eosinophils. In this article, we will discuss the structure, activity, and applications of Recombinant Human CD125/IL5RA Protein.

Structure

The Recombinant Human CD125/IL5RA Protein is a 70-kDa glycoprotein that is composed of 407 amino acids. It consists of a short cytoplasmic tail, a transmembrane domain, and an extracellular domain. The extracellular domain contains two fibronectin type III domains and a cytokine receptor homology region. The cytokine receptor homology region is responsible for binding to the cytokine Interleukin 5 (IL-5).

Activity

The primary function of Recombinant Human CD125/IL5RA Protein is to bind to IL-5 and initiate the signaling cascade that leads to the activation of eosinophils. IL-5 is a cytokine that is produced by T-cells and is involved in the regulation of eosinophil production, survival, and activation. When IL-5 binds to CD125/IL5RA, it induces dimerization with the IL-5 receptor beta subunit (CD131), which leads to the activation of downstream signaling pathways.

One of the main signaling pathways activated by CD125/IL5RA is the JAK-STAT pathway. This pathway plays a crucial role in the differentiation and maturation of eosinophils. CD125/IL5RA also activates the PI3K-AKT pathway, which is involved in the survival and proliferation of eosinophils. The activation of these pathways ultimately leads to the release of inflammatory mediators and the recruitment of eosinophils to sites of inflammation.

Applications

Recombinant Human CD125/IL5RA Protein has various applications in both research and clinical settings. One of the main applications of this protein is in the study of eosinophil biology and the role of IL-5 in immune responses. CD125/IL5RA can be used to study the signaling pathways involved in eosinophil activation and the development of eosinophilic diseases, such as asthma and allergic rhinitis.

In addition, Recombinant Human CD125/IL5RA Protein has therapeutic potential in the treatment of eosinophilic disorders. For instance, IL-5 is a key cytokine involved in the pathogenesis of eosinophilic esophagitis, and targeting CD125/IL5RA with monoclonal antibodies has shown promising results in clinical trials. This protein can also be used in the development of novel therapies for other eosinophilic diseases, such as hypereosinophilic syndrome and eosinophilic granulomatosis with polyangiitis.

Moreover, CD125/IL5RA is a potential target for cancer therapy. It has been found to be overexpressed in certain types of cancer, such as acute myeloid leukemia and multiple myeloma. Targeting CD125/IL5RA with monoclonal antibodies or small molecule inhibitors can potentially inhibit the growth and survival of cancer cells.

Conclusion

Recombinant Human CD125/IL5RA Protein is a key player in the regulation of immune responses, particularly in the development and activation of eosinophils. Its structure, activity, and applications make it an essential protein in the study of eosinophil biology and the development of novel therapies for eosinophilic disorders and cancer. Further research on this protein may lead to a better understanding of the immune system and the development of more effective treatments for various diseases.

Recombinant Human CD125/IL5RA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD125/IL5RA Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products