Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GADD45GIP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TAE8
Molecular weight:
22.68 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Thr47–Ser222
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GADD45GIP1 Protein, N-His

Product name ARO-P11669-100
Uniprot ID Q8TAE8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Molecular weight 22.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr47-Ser222
Aliases /Synonyms CRIF1, GADD45GIP1, 39S ribosomal protein L59, mitochondrial, PLINP1, PLINP, MRP-L59, CKII beta-associating protein, Papillomavirus L2-interacting nuclear protein 1, PLINP-1, PRG6, CR6-interacting factor 1, MRPL59, p53-responsive gene 6 protein, Growth arrest and DNA damage-inducible proteins-interacting protein 1, Mitochondrial large ribosomal subunit protein mL64
Reference ARO-P11669
Note For research use only.
Molecular Constructor
Thr47–Ser222
Product name ARO-P11669-1MG
Uniprot ID Q8TAE8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Molecular weight 22.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr47-Ser222
Aliases /Synonyms CRIF1, GADD45GIP1, 39S ribosomal protein L59, mitochondrial, PLINP1, PLINP, MRP-L59, CKII beta-associating protein, Papillomavirus L2-interacting nuclear protein 1, PLINP-1, PRG6, CR6-interacting factor 1, MRPL59, p53-responsive gene 6 protein, Growth arrest and DNA damage-inducible proteins-interacting protein 1, Mitochondrial large ribosomal subunit protein mL64
Reference ARO-P11669
Note For research use only.
Molecular Constructor
Thr47–Ser222
Product name ARO-P11669-50
Uniprot ID Q8TAE8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Molecular weight 22.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr47-Ser222
Aliases /Synonyms CRIF1, GADD45GIP1, 39S ribosomal protein L59, mitochondrial, PLINP1, PLINP, MRP-L59, CKII beta-associating protein, Papillomavirus L2-interacting nuclear protein 1, PLINP-1, PRG6, CR6-interacting factor 1, MRPL59, p53-responsive gene 6 protein, Growth arrest and DNA damage-inducible proteins-interacting protein 1, Mitochondrial large ribosomal subunit protein mL64
Reference ARO-P11669
Note For research use only.
Molecular Constructor
Thr47–Ser222

Introduction

Recombinant Human GADD45GIP1 Protein, also known as Growth Arrest and DNA Damage-inducible Protein GADD45 Gamma Interacting Protein 1, is a protein that plays a crucial role in cellular processes such as DNA damage response, cell cycle regulation, and apoptosis. It is a highly conserved protein found in various organisms, including humans, and is encoded by the GADD45GIP1 gene.

Structure of Recombinant Human GADD45GIP1 Protein

The recombinant form of GADD45GIP1 protein is produced through genetic engineering techniques, where the gene for GADD45GIP1 is inserted into a suitable expression vector and then expressed in a host cell. The resulting protein is a 32 kDa polypeptide consisting of 281 amino acids. It contains a C-terminal coiled-coil domain that is responsible for its interaction with other proteins, including GADD45 proteins.

Activity of Recombinant Human GADD45GIP1 Protein

GADD45GIP1 protein is a multifunctional protein that has been shown to play a role in various cellular processes. It is primarily known for its involvement in the DNA damage response pathway, where it is activated in response to genotoxic stress. It interacts with GADD45 proteins, which are known to be involved in DNA repair and cell cycle arrest, and together they regulate the cellular response to DNA damage.

Moreover, GADD45GIP1 has also been found to play a role in cell cycle regulation. It has been shown to interact with and inhibit the activity of cyclin-dependent kinases, which are essential for cell cycle progression. This suggests that GADD45GIP1 may act as a negative regulator of cell cycle progression and may play a role in maintaining genomic stability.

Additionally, GADD45GIP1 has been implicated in apoptosis, or programmed cell death. It has been shown to interact with Bcl-2, a protein that regulates apoptosis, and this interaction may play a role in the balance between cell survival and death.

Application of Recombinant Human GADD45GIP1 Protein

The recombinant form of GADD45GIP1 protein has various applications in both research and clinical settings. It has been widely used as an antigen for the production of specific antibodies, which are essential tools in studying the function and regulation of GADD45GIP1 protein.

Moreover, the role of GADD45GIP1 in DNA damage response makes it a potential target for cancer therapy. It has been found to be downregulated in various types of cancer, and its overexpression has been shown to inhibit cancer cell growth and induce cell death. This suggests that GADD45GIP1 may have a tumor-suppressive role, and further research on its potential as a therapeutic target is ongoing.

Furthermore, GADD45GIP1 has been linked to various diseases, including neurodegenerative disorders and cardiovascular diseases. Its involvement in cell cycle regulation and apoptosis suggests that it may play a role in the pathogenesis of these diseases, and further research on its function in these contexts may lead to potential therapeutic interventions.

Conclusion

In summary, Recombinant Human GADD45GIP1 Protein is a multifunctional protein with important roles in DNA damage response, cell cycle regulation, and apoptosis. Its structure and activity have been extensively studied, and its potential applications in research and medicine make it a valuable protein for further investigation. As our understanding of GADD45GIP1 continues to grow, it may hold promise for the development of new treatments for various diseases.

Recombinant Human GADD45GIP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GADD45GIP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products