Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CCPG1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9ULG6
Molecular weight:
16.27 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Asn621–Gly735
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CCPG1 Protein, N-His

Product name ARO-P10656-100
Uniprot ID Q9ULG6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NSHSFRKACSGVFDCAQQESMSLFNTVVNPIRMDEFRQIIQRYMLKELDTFCHWNELDQFINKFFLNGVFIHDQKLFTDFVNDVKDYLRNMKEYEVDNDGVFEKLDEYIYRHFFG
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn621-Gly735
Aliases /Synonyms Cell cycle progression restoration protein 8, CCPG1, CPR8, CCP8, KIAA1254, Cell cycle progression protein 1
Reference ARO-P10656
Note For research use only.
Molecular Constructor
Asn621–Gly735
Product name ARO-P10656-1MG
Uniprot ID Q9ULG6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NSHSFRKACSGVFDCAQQESMSLFNTVVNPIRMDEFRQIIQRYMLKELDTFCHWNELDQFINKFFLNGVFIHDQKLFTDFVNDVKDYLRNMKEYEVDNDGVFEKLDEYIYRHFFG
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn621-Gly735
Aliases /Synonyms Cell cycle progression restoration protein 8, CCPG1, CPR8, CCP8, KIAA1254, Cell cycle progression protein 1
Reference ARO-P10656
Note For research use only.
Molecular Constructor
Asn621–Gly735
Product name ARO-P10656-50
Uniprot ID Q9ULG6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NSHSFRKACSGVFDCAQQESMSLFNTVVNPIRMDEFRQIIQRYMLKELDTFCHWNELDQFINKFFLNGVFIHDQKLFTDFVNDVKDYLRNMKEYEVDNDGVFEKLDEYIYRHFFG
Molecular weight 16.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn621-Gly735
Aliases /Synonyms Cell cycle progression restoration protein 8, CCPG1, CPR8, CCP8, KIAA1254, Cell cycle progression protein 1
Reference ARO-P10656
Note For research use only.
Molecular Constructor
Asn621–Gly735

Introduction

Recombinant Human CCPG1 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein is an important antigen that plays a crucial role in various biological processes. In this article, we will discuss the structure, activity, and applications of Recombinant Human CCPG1 Protein.

Structure of Recombinant Human CCPG1 Protein

Recombinant Human CCPG1 Protein is a 35 kDa protein that is composed of 316 amino acids. It has a unique structure consisting of a signal peptide, a propeptide, and a mature peptide. The signal peptide is responsible for targeting the protein to the endoplasmic reticulum, where it undergoes post-translational modifications. The propeptide is cleaved off during this process, resulting in the mature peptide that is responsible for the biological activity of the protein.

Recombinant Human CCPG1 Protein also contains several conserved domains, including a cysteine-rich domain, a glycosaminoglycan-binding domain, and a C-terminal domain. These domains play a crucial role in the function and activity of the protein.

Activity of Recombinant Human CCPG1 Protein

Recombinant Human CCPG1 Protein is a multifunctional protein that has been shown to have various activities in different biological processes. It is primarily known for its role in cell adhesion and migration. It has been shown to interact with different extracellular matrix proteins, such as fibronectin and laminin, and promote cell adhesion and migration.

In addition to its role in cell adhesion, Recombinant Human CCPG1 Protein also has anti-angiogenic properties. It inhibits the formation of new blood vessels, which is crucial in various diseases, such as cancer and diabetic retinopathy.

Moreover, Recombinant Human CCPG1 Protein has been shown to have anti-inflammatory properties. It can inhibit the production of pro-inflammatory cytokines and chemokines, thus reducing inflammation in various diseases.

Applications of Recombinant Human CCPG1 Protein

Due to its diverse activities, Recombinant Human CCPG1 Protein has a wide range of applications in the field of biomedicine. One of its primary applications is in tissue engineering. It can be used to promote cell adhesion and migration, which is crucial in tissue regeneration and repair.

Recombinant Human CCPG1 Protein also has potential therapeutic applications in various diseases. Its anti-angiogenic and anti-inflammatory properties make it a promising candidate for the treatment of cancer, diabetic retinopathy, and other inflammatory diseases.

Furthermore, Recombinant Human CCPG1 Protein has been shown to have potential diagnostic applications. It can be used as a biomarker for certain diseases, as its levels have been found to be altered in various pathological conditions.

Conclusion

In conclusion, Recombinant Human CCPG1 Protein is a highly purified and biologically active protein with a unique structure and diverse activities. It has potential applications in tissue engineering, therapeutics, and diagnostics. Further research on this protein can lead to a better understanding of its role in various biological processes and its potential use in the treatment of diseases.

Recombinant Human CCPG1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CCPG1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products