Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FCN1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O00602
Molecular weight:
24.31 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Gly130–Ala326
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FCN1 Protein, N-His

Product name ARO-P11156-100
Uniprot ID O00602
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
Molecular weight 24.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly130-Ala326
Aliases /Synonyms Ficolin-alpha, FCNM, Ficolin-A, FCN1, Ficolin-1, Collagen/fibrinogen domain-containing protein 1, M-ficolin
Reference ARO-P11156
Note For research use only.
Molecular Constructor
Gly130–Ala326
Product name ARO-P11156-1MG
Uniprot ID O00602
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
Molecular weight 24.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly130-Ala326
Aliases /Synonyms Ficolin-alpha, FCNM, Ficolin-A, FCN1, Ficolin-1, Collagen/fibrinogen domain-containing protein 1, M-ficolin
Reference ARO-P11156
Note For research use only.
Molecular Constructor
Gly130–Ala326
Product name ARO-P11156-50
Uniprot ID O00602
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
Molecular weight 24.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly130-Ala326
Aliases /Synonyms Ficolin-alpha, FCNM, Ficolin-A, FCN1, Ficolin-1, Collagen/fibrinogen domain-containing protein 1, M-ficolin
Reference ARO-P11156
Note For research use only.
Molecular Constructor
Gly130–Ala326

Introduction to Recombinant Human FCN1 Protein

Recombinant Human FCN1 Protein, also known as Ficolin-1, is a type of recombinant protein that plays a crucial role in the immune system. It is a member of the ficolin family, which are soluble pattern recognition receptors (PRRs) that are involved in the innate immune response. FCN1 is primarily produced by the liver and is found in the blood and other body fluids. In this article, we will explore the structure, activity, and applications of Recombinant Human FCN1 Protein.

Structure of Recombinant Human FCN1 Protein

The human FCN1 gene is located on chromosome 9 and is composed of 10 exons. The protein is made up of 313 amino acids and has a molecular weight of approximately 35 kDa. It is composed of a leader peptide, a collagen-like domain, and a fibrinogen-like domain. The collagen-like domain contains a triple-helical structure, which is essential for the protein’s binding activity. The fibrinogen-like domain is responsible for recognizing and binding to specific target molecules, known as antigens.

Activity of Recombinant Human FCN1 Protein

Recombinant Human FCN1 Protein is a potent activator of the complement system, which is a vital part of the immune system. The complement system is a cascade of proteins that work together to eliminate pathogens and damaged cells. FCN1 can directly bind to microbial surfaces and activate the complement system, leading to the formation of a membrane attack complex that destroys the target cell. It can also act as an opsonin, which is a molecule that enhances the phagocytosis of pathogens by immune cells.

In addition to its role in the complement system, FCN1 also has the ability to bind to various other molecules, including carbohydrates, lipids, and nucleic acids. This broad binding specificity allows it to recognize a wide range of antigens, making it an essential component of the innate immune response.

Applications of Recombinant Human FCN1 Protein

Recombinant Human FCN1 Protein has various applications in both research and clinical settings. Its ability to activate the complement system and enhance phagocytosis makes it a valuable tool for studying the innate immune response to different pathogens. It has also been used in studies investigating the role of FCN1 in autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis.

In the clinical setting, FCN1 has potential as a diagnostic marker for certain diseases. For example, low levels of FCN1 have been associated with an increased risk of infections, making it a potential biomarker for monitoring immune function. Additionally, FCN1 has been studied as a potential therapeutic target for various diseases, including cancer and inflammatory disorders. Its ability to activate the complement system and enhance phagocytosis could be harnessed to develop novel treatments for these conditions.

Conclusion

In summary, Recombinant Human FCN1 Protein is a crucial component of the innate immune response. Its unique structure and broad binding specificity allow it to recognize a wide range of antigens and activate the complement system to eliminate pathogens. It has various applications in research and potential clinical uses, making it an essential protein in the field of immunology.

Keywords: Recombinant protein, antigen, FCN1, ficolin-1, innate immune response, complement system, opsonin, biomarker, therapeutic target.

Recombinant Human FCN1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FCN1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products