Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARID3A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99856
Molecular weight:
17.71 kDa

Original price was: €281.00.Current price is: €230.00.

50ug 18% OFF + 230 loyalty points
Gly221–Arg351
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARID3A Protein, N-His

Product name ARO-P11257-100
Uniprot ID Q99856
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Molecular weight 17.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly221-Arg351
Aliases /Synonyms Bright, DRIL3, E2F-binding protein 1, ARID domain-containing protein 3A, ARID3A, DRX, E2FBP1, DRIL1, AT-rich interactive domain-containing protein 3A, B-cell regulator of IgH transcription, Dead ringer-like protein 1
Reference ARO-P11257
Note For research use only.
Molecular Constructor
Gly221–Arg351
Product name ARO-P11257-1MG
Uniprot ID Q99856
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Molecular weight 17.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly221-Arg351
Aliases /Synonyms Bright, DRIL3, E2F-binding protein 1, ARID domain-containing protein 3A, ARID3A, DRX, E2FBP1, DRIL1, AT-rich interactive domain-containing protein 3A, B-cell regulator of IgH transcription, Dead ringer-like protein 1
Reference ARO-P11257
Note For research use only.
Molecular Constructor
Gly221–Arg351
Product name ARO-P11257-50
Uniprot ID Q99856
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDWTYEEQFKQLYELDGDPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRR
Molecular weight 17.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly221-Arg351
Aliases /Synonyms Bright, DRIL3, E2F-binding protein 1, ARID domain-containing protein 3A, ARID3A, DRX, E2FBP1, DRIL1, AT-rich interactive domain-containing protein 3A, B-cell regulator of IgH transcription, Dead ringer-like protein 1
Reference ARO-P11257
Note For research use only.
Molecular Constructor
Gly221–Arg351

The Structure of Recombinant Human ARID3A Protein

Recombinant Human ARID3A Protein, also known as AT-rich interactive domain-containing protein 3A, is a transcription factor that plays a crucial role in regulating gene expression and cell differentiation. It is a 47 kDa protein composed of 422 amino acids, encoded by the ARID3A gene located on chromosome 19.

The protein structure of ARID3A is characterized by three distinct domains: the AT-rich interaction domain (ARID), the glutamine-rich (Q-rich) domain, and the serine/threonine-rich (S/T-rich) domain. The ARID domain is responsible for DNA binding and recognition, while the Q-rich and S/T-rich domains are involved in protein-protein interactions.

The Activity of Recombinant Human ARID3A Protein

The primary function of ARID3A protein is to regulate gene expression by binding to specific DNA sequences and recruiting other transcription factors and co-regulators to the promoter regions. This interaction leads to the activation or repression of target genes, depending on the cellular context.

Studies have shown that ARID3A is essential for embryonic development and plays a critical role in cell fate determination and differentiation of various cell types, including B and T lymphocytes, neural crest cells, and hematopoietic stem cells. It also plays a crucial role in maintaining the self-renewal capacity of embryonic stem cells.

Furthermore, ARID3A has been implicated in various diseases, including cancer, where it acts as an oncogene or tumor suppressor depending on the cellular context. It is overexpressed in several types of cancers, including breast, lung, and colon cancer, and its expression has been associated with poor prognosis and drug resistance.

The Applications of Recombinant Human ARID3A Protein

Recombinant Human ARID3A Protein has various applications in both research and therapeutic settings. In research, it is used as a tool to study the role of ARID3A in gene regulation and cell differentiation. It can be used to overexpress or knockdown ARID3A in cell lines or animal models to understand its function in different cellular processes.

In therapeutic applications, ARID3A has shown potential as a target for cancer therapy. Inhibiting ARID3A expression or activity has been shown to reduce tumor growth and sensitize cancer cells to chemotherapy. Therefore, recombinant ARID3A protein can be used in drug discovery and development to identify potential inhibitors or activators of ARID3A for cancer treatment.

Another potential therapeutic application of recombinant ARID3A protein is in stem cell research. As ARID3A plays a crucial role in maintaining the self-renewal capacity of embryonic stem cells, it can be used to enhance the efficiency of stem cell culture and differentiation protocols.

In conclusion, Recombinant Human ARID3A Protein is a crucial transcription factor with diverse roles in gene regulation and cell differentiation. Its unique structure and activity make it an essential tool for research and a potential target for cancer therapy and stem cell research. Further studies on ARID3A and its interaction with other proteins will provide a deeper understanding of its function and potential applications in various fields.

Recombinant Human ARID3A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARID3A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products