Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human CBX1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P83916
Molecular weight:
18.87 kDa

Original price was: €421.00.Current price is: €329.00.

100ug 22% OFF + 329 loyalty points
Glu24–Leu168
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human CBX1 Protein, N-His

Recombinant Human CBX1 Protein, N-His

Product name ARO-P12196-100
Uniprot ID P83916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERL
Molecular weight 18.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu24-Leu168
Aliases /Synonyms HP1Hsbeta, CBX, Chromobox protein homolog 1, Modifier 1 protein, Heterochromatin protein 1 homolog beta, HP1 beta, M31, CBX1, p25beta, Heterochromatin protein p25
Reference ARO-P12196
Note For research use only.
Molecular Constructor
Glu24–Leu168
Product name ARO-P12196-1MG
Uniprot ID P83916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERL
Molecular weight 18.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu24-Leu168
Aliases /Synonyms HP1Hsbeta, CBX, Chromobox protein homolog 1, Modifier 1 protein, Heterochromatin protein 1 homolog beta, HP1 beta, M31, CBX1, p25beta, Heterochromatin protein p25
Reference ARO-P12196
Note For research use only.
Molecular Constructor
Glu24–Leu168
Product name ARO-P12196-50
Uniprot ID P83916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERL
Molecular weight 18.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu24-Leu168
Aliases /Synonyms HP1Hsbeta, CBX, Chromobox protein homolog 1, Modifier 1 protein, Heterochromatin protein 1 homolog beta, HP1 beta, M31, CBX1, p25beta, Heterochromatin protein p25
Reference ARO-P12196
Note For research use only.
Molecular Constructor
Glu24–Leu168

Recombinant Human CBX1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CBX1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products