Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human POFUT2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2G5
Molecular weight:
15.99 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Pro53–Tyr167
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human POFUT2 Protein, N-His

Product name ARO-P10653-100
Uniprot ID Q9Y2G5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro53-Tyr167
Aliases /Synonyms POFUT2, FUT13, Peptide-O-fucosyltransferase 2, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, C21orf80, O-FucT-2
Reference ARO-P10653
Note For research use only.
Molecular Constructor
Pro53–Tyr167
Product name ARO-P10653-1MG
Uniprot ID Q9Y2G5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro53-Tyr167
Aliases /Synonyms POFUT2, FUT13, Peptide-O-fucosyltransferase 2, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, C21orf80, O-FucT-2
Reference ARO-P10653
Note For research use only.
Molecular Constructor
Pro53–Tyr167
Product name ARO-P10653-50
Uniprot ID Q9Y2G5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro53-Tyr167
Aliases /Synonyms POFUT2, FUT13, Peptide-O-fucosyltransferase 2, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, C21orf80, O-FucT-2
Reference ARO-P10653
Note For research use only.
Molecular Constructor
Pro53–Tyr167

Introduction

Recombinant Human POFUT2 Protein, also known as Protein O-fucosyltransferase 2, is a glycosyltransferase enzyme that plays a crucial role in the post-translational modification of proteins. This protein is encoded by the POFUT2 gene and is highly conserved across different species. Recombinant Human POFUT2 Protein is widely used in various research studies and has potential applications in the development of therapeutics.

Structure of Recombinant Human POFUT2 Protein

Recombinant Human POFUT2 Protein is a type II transmembrane protein, with a molecular weight of approximately 50 kDa. It consists of a short cytoplasmic domain, a transmembrane region, and a large luminal domain. The luminal domain contains a catalytic region that is responsible for the transfer of fucose to specific serine or threonine residues on target proteins.

Activity of Recombinant Human POFUT2 Protein

Recombinant Human POFUT2 Protein catalyzes the transfer of fucose from GDP-fucose to the serine or threonine residues of target proteins. This process is known as O-fucosylation and is essential for the proper folding and function of many proteins. The addition of fucose to these specific residues creates a unique post-translational modification that is crucial for the activity and stability of the target protein.

Application of Recombinant Human POFUT2 Protein

1. Recombinant Human POFUT2 Protein in Protein Modification Studies
Recombinant Human POFUT2 Protein is widely used in research studies to investigate the role of O-fucosylation in protein modification. By adding fucose to specific residues on target proteins, researchers can study the effects of this post-translational modification on protein structure and function. This has led to a better understanding of the role of O-fucosylation in various biological processes, such as cell signaling and development.

2. Recombinant Human POFUT2 Protein in Therapeutic Development
The unique post-translational modification catalyzed by Recombinant Human POFUT2 Protein makes it a potential target for therapeutic development. Abnormal O-fucosylation has been linked to various diseases, including cancer and neurodegenerative disorders. By targeting the activity of POFUT2, researchers can potentially develop treatments for these diseases.

3. Recombinant Human POFUT2 Protein as an Antigen
Recombinant Human POFUT2 Protein has also been used as an antigen in immunological studies. The addition of fucose to specific residues on target proteins can create neo-antigens, which can elicit an immune response. This has been utilized in the development of vaccines and diagnostic tools for various diseases.

4. Recombinant Human POFUT2 Protein as a Biomarker
Aberrant expression of POFUT2 has been observed in various cancers, making it a potential biomarker for disease diagnosis and prognosis. Recombinant Human POFUT2 Protein can be used in biomarker discovery studies to identify potential targets for cancer treatment.

5. Recombinant Human POFUT2 Protein in Glycoengineering
Glycoengineering is the process of modifying the sugar structures on proteins to enhance their properties. Recombinant Human POFUT2 Protein can be used in this process to add fucose to specific residues on target proteins, altering their function and stability. This has potential applications in the development of novel therapeutics and biotechnological products.

Conclusion

Recombinant Human POFUT2 Protein is a crucial enzyme involved in the post-translational modification of proteins. Its unique activity of adding fucose to specific residues on target proteins has various applications in research and therapeutics. With ongoing studies and advancements in the field of glycoscience, Recombinant Human POFUT2 Protein holds great potential for future developments in medicine and biotechnology.

Recombinant Human POFUT2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human POFUT2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products